DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bwa and Acer1

DIOPT Version :9

Sequence 1:NP_001260616.1 Gene:bwa / 250736 FlyBaseID:FBgn0045064 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_783858.1 Gene:Acer1 / 171168 MGIID:2181962 Length:273 Species:Mus musculus


Alignment Length:253 Identity:98/253 - (38%)
Similarity:157/253 - (62%) Gaps:0/253 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SSPVDWCEGNYLISSNIAEFVNTFSNFLFILLPPVLIMLFKEYGRFVTPGIHVIWVLLIVVGLSS 88
            ||.|||||.|:..|..:|||.|||||..|::..|:::.|...|.:..|...:.:.||.:::||.|
Mouse    18 SSEVDWCESNFQHSELVAEFYNTFSNVFFLIFGPLMMFLMHPYAQKRTRCFYGVSVLFMLIGLFS 82

  Fly    89 MYFHATLSLIGQLLDELAILWVFMAAFSLFYPKRYYPKFVKNDRKTFSWLMLLSAIAATGLSWWK 153
            ||||.|||.:||||||::|||:..:.:|::.|:.|:|||||.:|..||.|:.::.|.:|.|::.|
Mouse    83 MYFHMTLSFLGQLLDEISILWLLASGYSVWLPRCYFPKFVKGNRFYFSCLVTITTIISTFLTFVK 147

  Fly   154 PIVNAFVLMFMSVPTMVMLYTELQRVSDQRVYRLGIRSTTVWAVAVFCWINDRIFCEAWSSINFP 218
            |.|||:.|..:::..:.::.||.:::.|..:..|...|..:||.|:..||:||:.|..|..|:|.
Mouse   148 PTVNAYALNSIAIHILYIVRTEYKKIRDDDLRHLIAVSVVLWAAALTSWISDRVLCSFWQRIHFY 212

  Fly   219 YLHGFWHIFIFIAAYTVLVLFAYFYVESELPQRQPLLKYWPKNEFEFGIPFISIRNPD 276
            |||..||:.|.|.....:|..|....:.|:|.:...:.|||::.:..|:|::.|:..|
Mouse   213 YLHSIWHVLISITFPYGIVTMALVDAKYEMPDKTLKVHYWPRDSWVIGLPYVEIQEND 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bwaNP_001260616.1 Ceramidase 22..270 CDD:283521 96/245 (39%)
Acer1NP_783858.1 Ceramidase 12..264 CDD:283521 96/245 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2329
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467572at33208
OrthoFinder 1 1.000 - - FOG0003532
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.