DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bwa and ACER1

DIOPT Version :9

Sequence 1:NP_001260616.1 Gene:bwa / 250736 FlyBaseID:FBgn0045064 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_597999.1 Gene:ACER1 / 125981 HGNCID:18356 Length:264 Species:Homo sapiens


Alignment Length:256 Identity:99/256 - (38%)
Similarity:159/256 - (62%) Gaps:1/256 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SSPVDWCEGNYLISSNIAEFVNTFSNFLFILLPPVLIMLFKEYGRFVTPGIHVIWVLLIVVGLSS 88
            ||.|||||.|:..|..:|||.|||||..|.:..|::::|...|.:..:..|:|:|||.:::||.|
Human     9 SSEVDWCESNFQYSELVAEFYNTFSNIPFFIFGPLMMLLMHPYAQKRSRYIYVVWVLFMIIGLFS 73

  Fly    89 MYFHATLSLIGQLLDELAILWVFMAAFSLFYPKRYYPKFVKNDRKTFSWLMLLSAIAATGLSWWK 153
            ||||.|||.:||||||:||||:..:.:|::.|:.|:|.|:..:|..|..|:.::.:.:|.||:.:
Human    74 MYFHMTLSFLGQLLDEIAILWLLGSGYSIWMPRCYFPSFLGGNRSQFIRLVFITTVVSTLLSFLR 138

  Fly   154 PIVNAFVLMFMSVPTMVMLYTELQRVSDQRVYRLGIRSTTVWAVAVFCWINDRIFCEAWSSINFP 218
            |.|||:.|..:::..:.::..|.::.|::.:..|...|..:||||:..||:||:.|..|..|:|.
Human   139 PTVNAYALNSIALHILYIVCQEYRKTSNKELRHLIEVSVVLWAVALTSWISDRLLCSFWQRIHFF 203

  Fly   219 YLHGFWHIFIFIAAYTVLVLFAYFYVESELPQRQPLLKYWPKNEFEFGIPFISIRNPDSKD 279
            |||..||:.|.|.....:|..|......|:|.....::|||::.:..|:|::.||. |.||
Human   204 YLHSIWHVLISITFPYGMVTMALVDANYEMPGETLKVRYWPRDSWPVGLPYVEIRG-DDKD 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bwaNP_001260616.1 Ceramidase 22..270 CDD:283521 94/245 (38%)
ACER1NP_597999.1 Ceramidase 3..255 CDD:368648 94/245 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2329
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467572at33208
OrthoFinder 1 1.000 - - FOG0003532
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.