DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bwa and acer3

DIOPT Version :9

Sequence 1:NP_001260616.1 Gene:bwa / 250736 FlyBaseID:FBgn0045064 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001106437.1 Gene:acer3 / 100127611 XenbaseID:XB-GENE-994450 Length:267 Species:Xenopus tropicalis


Alignment Length:289 Identity:90/289 - (31%)
Similarity:134/289 - (46%) Gaps:65/289 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RPG-----SSPVDWCEGNYLISSNIAEFVNTFSNFLFILLPPVLIMLFKEYG--RFVTPGIH--- 75
            |||     :|.::|||.||.:|..||||.||.|| |.::|||:       ||  :.|..|:.   
 Frog     7 RPGYWGPPTSTLEWCEENYAVSFYIAEFWNTVSN-LIMILPPI-------YGAIQTVRDGLETRY 63

  Fly    76 -VIWVLLIVVGLSSMYFHATLSLIGQLLDELAILWVFMAAFSLFYPKRYYPKFVKNDRKTFSWLM 139
             |.::.|..|||.|..||.||....||||||.:::    :.|:|....|  :..|| |.::::|:
 Frog    64 LVSYLGLAAVGLGSWCFHMTLQYEMQLLDELPMIY----SCSVFVYCLY--ECFKN-RNSYNYLL 121

  Fly   140 LL-----SAIAAT-GLSWWKPIVNAFV-------LMFMSVPTMVMLYTELQRVSDQRVYRLGIRS 191
            |:     |.|..| .|.|.:|:.:..:       |:..||..:..:|..|:        .|...|
 Frog   122 LILLILFSLIVTTVYLRWKEPVFHQVMYGLLVSFLVLRSVYIVTWVYPWLR--------GLAYTS 178

  Fly   192 TTVWAVAVFCWINDRIFCEAWSSIN---------FPYLHGFWHIFIFIAAYTVLVLFAYFYVESE 247
            ..|:.:....|..|.|||..|..:.         ....|.:|||...:.:| :.:||:.:     
 Frog   179 LGVFLLGFVLWNVDNIFCSTWREVRQKVPPVVGAVTQFHAWWHILTGLGSY-LHILFSLY----- 237

  Fly   248 LPQRQPLLKYWPKNEFEFGI-PFISIRNP 275
              .|...|||.||.:|.||: |.|.:.||
 Frog   238 --TRTLYLKYRPKVKFMFGMWPVIMVENP 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bwaNP_001260616.1 Ceramidase 22..270 CDD:283521 86/281 (31%)
acer3NP_001106437.1 Ceramidase 9..256 CDD:310456 84/277 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D969354at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2379
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.