DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Camk4 and CG10177

DIOPT Version :9

Sequence 1:NP_036859.2 Gene:Camk4 / 25050 RGDID:2264 Length:474 Species:Rattus norvegicus
Sequence 2:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster


Alignment Length:265 Identity:76/265 - (28%)
Similarity:129/265 - (48%) Gaps:17/265 - (6%)


- Green bases have known domain annotations that are detailed below.


  Rat    41 FFEVESELGRGATSIVYRCKQKGTQKPYALKVLKKTV---DKKIVRTEIGVLLRL-SHPNIIKLK 101
            :.|....:.....:::||.:.:..:....:|::.|..   |:.....|..||.:| ||||||:|.
  Fly   148 YIETIEPVEHNTRTLIYRGQTRANRTKCTVKMVNKQTQSNDRGDTYMEAEVLRQLQSHPNIIELM 212

  Rat   102 EIFETPTEISLVLELVTGGELFDRIVEK-GYYSERDAADAVKQILEAVAYLHENGIVHRDLKPEN 165
            ...|....:..|||.:...  ..::::| |..||.||...::..:.|:|::|:..::|||:||||
  Fly   213 YTVEDERYMYTVLEHLDCN--MQKVIQKRGILSEADARSVMRCTVSALAHMHQLQVIHRDIKPEN 275

  Rat   166 LLYATPAPD---APLKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIIT 227
            ||..:.:..   ..:|:|:|.|:.......|. ..||||.|.|||::....|..:||.||:|:..
  Fly   276 LLVCSSSGKWNFKMVKVANFDLATYYRGSKLY-VRCGTPCYMAPEMIAMSGYDYQVDSWSLGVTL 339

  Rat   228 YILLCGFEPFYDE-RGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVKKLIVLDPKKR-----LT 286
            :.:|||..||... :..:.::..|::....:.......:|..|..|:..|:|.||..|     |.
  Fly   340 FYMLCGKMPFASACKNSKEIYAAIMSGGPTYPKDMESVMSPEATQLIDGLLVSDPSYRVPIAELD 404

  Rat   287 TFQAL 291
            .||.|
  Fly   405 KFQFL 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Camk4NP_036859.2 STKc_CaMKIV 38..331 CDD:270987 76/265 (29%)
Autoinhibitory domain 297..336
PP2A-binding. /evidence=ECO:0000250 302..319
Calmodulin-binding. /evidence=ECO:0000255 318..337
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 336..474
CG10177NP_651150.1 DCX 18..108 CDD:214711
S_TKc 164..409 CDD:214567 74/247 (30%)
PKc_like 164..403 CDD:304357 71/241 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.