DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Fcer1a and bdl

DIOPT Version :9

Sequence 1:	NP_036856.1	Gene:	Fcer1a / 25047	RGDID:	2597	Length:	245	Species:	Rattus norvegicus
Sequence 2:	NP_608822.1	Gene:	bdl / 33635	FlyBaseID:	FBgn0028482	Length:	719	Species:	Drosophila melanogaster

Alignment Length:	109	Identity:	26/109 - (23%)
Similarity:	47/109 - (43%)	Gaps:	17/109 - (15%)

- Green bases have known domain annotations that are detailed below.

  Rat    83 IQDSGKYICQ---KQGFYKSKPVYLNVMQEWLLLQSSADVVLDNGS---FDIRCRSWKKWKVHKV 141
            :.|.|:|.|:   ..|..::...:||:..:..::.:..:|.|..|.   .|...|:....|  .:
  Fly   216 MSDLGEYECKVRNSDGELQTAKAFLNIQYKAKVIYAPPEVFLPYGQPAVLDCHFRANPPLK--NL 278

  Rat   142 IYYKDDIAFKYSYD--------SNNISIRKATFNDSGSYHCTGY 177
            .:.||.:.|. ||:        :.::...|...|.:|||.||.|
  Fly   279 RWEKDGLLFD-SYNVPGVFYKMNGSLFFAKVDENHAGSYTCTPY 321

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Fcer1a	NP_036856.1	Ig1_FcgammaR_like	28..106	CDD:143229	6/25 (24%)
		IG_like	34..106	CDD:214653	6/25 (24%)
		Ig2_FcgammaR_like	110..192	CDD:143230	19/79 (24%)
		IG_like	119..182	CDD:214653	19/70 (27%)
bdl	NP_608822.1	IG_like	42..128	CDD:214653
		Ig	43..131	CDD:299845
		I-set	153..242	CDD:254352	6/25 (24%)
		Ig	157..242	CDD:299845	6/25 (24%)
		Ig_2	252..337	CDD:290606	19/73 (26%)
		IG_like	260..327	CDD:214653	17/65 (26%)
		I-set	341..428	CDD:254352
		IGc2	356..419	CDD:197706
		FN3	435..524	CDD:238020
		FN3	554..636	CDD:238020
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	0	0.000