DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sstr1 and AstC-R1

DIOPT Version :9

Sequence 1:NP_036851.1 Gene:Sstr1 / 25033 RGDID:3762 Length:391 Species:Rattus norvegicus
Sequence 2:NP_649040.2 Gene:AstC-R1 / 40020 FlyBaseID:FBgn0036790 Length:483 Species:Drosophila melanogaster


Alignment Length:316 Identity:119/316 - (37%)
Similarity:196/316 - (62%) Gaps:15/316 - (4%)


- Green bases have known domain annotations that are detailed below.


  Rat    64 IYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLLRHWPFGAL 128
            :|..||::||.||::||||:||::||:|.|||||||||:|||..::.:|||:.:..:..|.||..
  Fly    83 LYGFVCIIGLFGNTLVIYVVLRFSKMQTVTNIYILNLAVADECFLIGIPFLLYTMRICSWRFGEF 147

  Rat   129 LCRLVLSVDAVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGVWVLSLLVILPIV 193
            :|:..:...::..|||...|.::|.|||:||.|||.:.|||...:||||:...|..|.:::||::
  Fly   148 MCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSPRYRTLHIAKVVSAIAWSTSAVLMLPVI 212

  Rat   194 VFSRTAANSDG-TVACNMLMPEPAQRWL-VGFVLYTFLMGFLLPVGAICLCYVLIIAKMRMVALK 256
            :::.|....|| ..:||::.|:..::.. ..|:||||.:||..|:..|...|.|:|.|:|.|..|
  Fly   213 LYASTVEQEDGINYSCNIMWPDAYKKHSGTTFILYTFFLGFATPLCFILSFYYLVIRKLRSVGPK 277

  Rat   257 AGW--QQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQDDATVSQLSVI-------LG 312
            .|.  ::::|:.||:|.:|:.|:.|:::||:|.::.|:..:.:......:|:|.::       |.
  Fly   278 PGTKSKEKRRAHRKVTRLVLTVISVYILCWLPHWISQVALIHSNPAQRDLSRLEILIFLLLGALV 342

  Rat   313 YANSCANPILYGFLSDNFKRS-FQRILCLSWMDNAAE---EPVDYYATALKSRAYS 364
            |:||..|||||.|||:||::| |:...|::..|..|:   ||..:.....|.|..|
  Fly   343 YSNSAVNPILYAFLSENFRKSFFKAFTCMNKQDINAQLQLEPSVFTKQGSKKRGGS 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sstr1NP_036851.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50
7tm_4 67..>189 CDD:304433 56/121 (46%)
7tm_1 75..323 CDD:278431 97/258 (38%)
AstC-R1NP_649040.2 7tm_4 88..368 CDD:304433 109/279 (39%)
7tm_1 94..353 CDD:278431 97/258 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 223 1.000 Domainoid score I2480
eggNOG 1 0.900 - - E33208_3BCR0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 248 1.000 Inparanoid score I3165
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000463
OrthoInspector 1 1.000 - - mtm9091
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24229
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X22
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.960

Return to query results.
Submit another query.