powered by:
Protein Alignment Vars1 and GstE11
DIOPT Version :9
Sequence 1: | NP_445744.1 |
Gene: | Vars1 / 25009 |
RGDID: | 3950 |
Length: | 1264 |
Species: | Rattus norvegicus |
Sequence 2: | NP_001286575.1 |
Gene: | GstE11 / 37128 |
FlyBaseID: | FBgn0034354 |
Length: | 225 |
Species: | Drosophila melanogaster |
Alignment Length: | 64 |
Identity: | 20/64 - (31%) |
Similarity: | 29/64 - (45%) |
Gaps: | 7/64 - (10%) |
- Green bases have known domain annotations that are detailed below.
Rat 112 CGATLPALGL-------RGPGQDPQAALGALGKALNPLEEWLRLHTYLAGDAPTLADLAAVTAL 168
||...|.:.. .|.|:.|...:..|.||.:.||..|....||.||..|:|||:.:.::
Fly 107 CGHLFPRIRFIVEPVIYFGAGEVPSDRVAYLQKAYDGLEHCLAEGDYLVGDKLTIADLSCIASV 170
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0625 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.