DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ABL1 and LSB1

DIOPT Version :9

Sequence 1:NP_009297.2 Gene:ABL1 / 25 HGNCID:76 Length:1149 Species:Homo sapiens
Sequence 2:NP_011652.1 Gene:LSB1 / 853037 SGDID:S000003368 Length:241 Species:Saccharomyces cerevisiae


Alignment Length:122 Identity:33/122 - (27%)
Similarity:53/122 - (43%) Gaps:18/122 - (14%)


- Green bases have known domain annotations that are detailed below.


Human    66 RWNSKENLLAGPSENDPNLFV-ALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGW 129
            :|:..:.   .|...|...:| |||||.|..|..||:..|:|::|| ...:.:|...::.|..|.
Yeast    41 KWDGNQR---SPQNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVL-EKISPDWYRGKSNNKIGI 101

Human   130 VPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRY 186
            .|:||:.|.        :....|..:||...||.::     |.|...|.....:.:|
Yeast   102 FPANYVKPA--------FTRSASPKSAEAASSSTVS-----RPSVPPPSYEPAASQY 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ABL1NP_009297.2 SH3_Abl 84..137 CDD:212784 20/53 (38%)
SH2_ABL 142..235 CDD:198189 9/45 (20%)
PTKc_Abl 254..516 CDD:270645
Pkinase_Tyr 261..512 CDD:285015
FABD 1025..1149 CDD:197885
LSB1NP_011652.1 SH3 55..108 CDD:214620 20/53 (38%)
PRK14971 <100..>156 CDD:237874 14/59 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.