DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ABL1 and skb5

DIOPT Version :9

Sequence 1:NP_009297.2 Gene:ABL1 / 25 HGNCID:76 Length:1149 Species:Homo sapiens
Sequence 2:NP_588016.1 Gene:skb5 / 2539237 PomBaseID:SPCC24B10.13 Length:140 Species:Schizosaccharomyces pombe


Alignment Length:115 Identity:33/115 - (28%)
Similarity:51/115 - (44%) Gaps:16/115 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    34 HGGPHCNVFVEHEALQRPVASDFEP--QGLSEAAR-------WNSKENLLAGPSENDPNL--FVA 87
            |.|.|..|..|.|  :|.|...|:.  :|..::..       ::::|:....||.:...|  .||
pombe    25 HYGFHARVIEEEE--ERFVDDTFDETIEGSDDSESIDDTEVFYDAEESESTHPSASFNVLADAVA 87

Human    88 LYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEA--QTKNGQGWVPSNYI 135
            ||||....||.|..|.|::|.:|..:.:| |..|  ......|.||..::
pombe    88 LYDFEPLHDNELGFTTGQRLCILSESSDG-WLIAYDDASGRSGLVPETFV 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ABL1NP_009297.2 SH3_Abl 84..137 CDD:212784 20/56 (36%)
SH2_ABL 142..235 CDD:198189
PTKc_Abl 254..516 CDD:270645
Pkinase_Tyr 261..512 CDD:285015
FABD 1025..1149 CDD:197885
skb5NP_588016.1 SH3_Nbp2-like 84..138 CDD:212799 19/54 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.