DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hoe1 and Indy-2

DIOPT Version :9

Sequence 1:NP_001285607.1 Gene:hoe1 / 249663 FlyBaseID:FBgn0041150 Length:846 Species:Drosophila melanogaster
Sequence 2:NP_001027201.1 Gene:Indy-2 / 3772456 FlyBaseID:FBgn0260466 Length:562 Species:Drosophila melanogaster


Alignment Length:509 Identity:95/509 - (18%)
Similarity:182/509 - (35%) Gaps:148/509 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   357 IWEIVNRTFAAI-IASTLSVGILAALNSRPSM-ATIMGWID---------VETLLLLFGMMILVA 410
            :|.||  |.|.: |..||.:.:.|..   |.: ..::|.::         .:|:::..|.:|:..
  Fly    50 LWLIV--TMALLWITETLPIYVTALF---PLVFCPLLGLVNASIVCKQYFTDTIVVFLGGLIVAL 109

  Fly   411 ILSETGVFDYLAVYAYKITNGHVWPLINCLCLFTAVLSSFLDNVTTVLLMTPVTIRLCEVMCLN- 474
            .:..:.:...:|:...:|..|....|...|...:..:..::.|.....:|.|:...|...:..| 
  Fly   110 GIEYSNLHTRIALRVIRIVGGSPRRLFVGLMSVSTFMGLWISNSAGTAMMCPIVKALVNELDTNK 174

  Fly   475 ------------------PVPILMCMVIY------SNIGGALTPVGDPPNVI---IASNSY-ISK 511
                              |.|..:.:..|      |:|||..|.:|...|::   |.:..: .|.
  Fly   175 IFPVYMTQEEEPVEEGEPPHPSKITVAFYAGIAYASSIGGLGTLIGTGTNLVFRGIYTERFPTST 239

  Fly   512 NGVNFAVFTLHMLPGVLLVMVQTYIQLRFKFRNISDLQFKDSPEVEELRHEIHVWKRAAASLSAY 576
            ..:.||.|..:.:|.:::|.| |.:.:.|...::.  .|:.:.:..::..|.:..::..      
  Fly   240 VEITFANFMFYSIPLMVIVNV-TLVIIAFLITHMG--LFRPNSKTGKIIAEANTNRKLM------ 295

  Fly   577 SKDEELVRQTLMKKVNRLKRSLKKRMTAVIEPAPNYQQTLANLQAKYPIRNKPLLIKCSAALVFV 641
               |:::||..:.                :.|...::                  |:.:.|..|:
  Fly   296 ---EDVLRQRHID----------------LGPMSCHE------------------IQMAIAFAFM 323

  Fly   642 ISLFFLHS---VPELQRLSLGWTALL---------GAIFLIILA--------------------- 673
            |.|.....   ||       ||:.|:         |..|:::|.                     
  Fly   324 IVLLITRKPGFVP-------GWSDLINRKVVGSASGLSFIVLLIFALPTQYTFFKYCCGKGPFTA 381

  Fly   674 ----DIEDMEAILARVEWSTLLFFAALFILMEALTELGLIEWIGNMTEGIILGVGEDRRLMVAIL 734
                .|...|.:|..:.|..|......|.|..|..|.||...|....: :::|:..     :.:.
  Fly   382 QAIDAILSWEYVLRNIPWGLLFLLGGGFALAVASRETGLNIMISKAMQ-VLIGLPN-----IVVQ 440

  Fly   735 IILWVSA-VASAFVDNIPLTTMMVKITISLAQNSTLNLPLQPLVWALALGACLG 787
            .|.:|.| ..|||..|:.:..:::.|...:    :|.|.|.||:  |.|.||||
  Fly   441 SITFVLANFFSAFNANVVVANIVLPILCEM----SLALELHPLI--LTLPACLG 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hoe1NP_001285607.1 ArsB 345..839 CDD:223983 95/509 (19%)
P_permease 349..837 CDD:238536 95/509 (19%)
Indy-2NP_001027201.1 ArsB_NhaD_permease 50..533 CDD:304373 95/509 (19%)
dass 52..532 CDD:273267 94/507 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448700
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.