DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FTH1 and Fer3HCH

DIOPT Version :9

Sequence 1:NP_002023.2 Gene:FTH1 / 2495 HGNCID:3976 Length:183 Species:Homo sapiens
Sequence 2:NP_572854.1 Gene:Fer3HCH / 32260 FlyBaseID:FBgn0030449 Length:186 Species:Drosophila melanogaster


Alignment Length:167 Identity:76/167 - (45%)
Similarity:112/167 - (67%) Gaps:6/167 - (3%)


- Green bases have known domain annotations that are detailed below.


Human     9 VRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKL 73
            ||||:.:..|..:|.|||:||.||:.||:|:|:|||.|::.....::||..|.||||||||:|..
  Fly    16 VRQNFAKSCEKKLNDQINMELKASHQYLAMAYHFDRSDISSPGMHRFFLKASVEEREHAEKIMTY 80

Human    74 QNQRGGRIFLQDIKKP-DCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETH 137
            .|:|||.|.|..:.:| .|  :.|.|:|::.|:.:|..||:.||:||.||..:.||:||||||.:
  Fly    81 MNKRGGLIILSSVPQPLPC--FASTLDALKHAMKMELEVNKHLLDLHALAGKEADPNLCDFIEAN 143

Human   138 YLNEQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKH 174
            :|.|||...|.|.|:::.|.|   .::.:.|:||||:
  Fly   144 FLQEQVDGQKILADYISQLEK---AQNQVGEFLFDKY 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FTH1NP_002023.2 Euk_Ferritin 14..174 CDD:153114 71/160 (44%)
Fer3HCHNP_572854.1 Euk_Ferritin 24..177 CDD:153114 71/157 (45%)
Ferritin 25..165 CDD:278632 67/144 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 128 1.000 Domainoid score I5305
eggNOG 1 0.900 - - E1_COG1528
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I4447
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249457at2759
OrthoFinder 1 1.000 - - FOG0000169
OrthoInspector 1 1.000 - - otm41906
orthoMCL 1 0.900 - - OOG6_100688
Panther 1 1.100 - - LDO PTHR11431
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4342
SonicParanoid 1 1.000 - - X152
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.