DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grpr and CCHa1-R

DIOPT Version :9

Sequence 1:NP_036838.1 Gene:Grpr / 24938 RGDID:2750 Length:384 Species:Rattus norvegicus
Sequence 2:NP_611241.2 Gene:CCHa1-R / 37004 FlyBaseID:FBgn0050106 Length:499 Species:Drosophila melanogaster


Alignment Length:339 Identity:131/339 - (38%)
Similarity:202/339 - (59%) Gaps:25/339 - (7%)


- Green bases have known domain annotations that are detailed below.


  Rat    42 YVIPAVYGLIIVIGLIGNITLIKIFCTVKSMRNVPNLFISSLALGDLLLLVTCAPVDASKYLADR 106
            |::|.::.||.|:|::||.|||.:|.:|:.||||||.:|.||||.|||:::|..|:.::.|..:.
  Fly    82 YIVPILFALIFVVGVLGNGTLIVVFLSVRQMRNVPNTYILSLALADLLVIITTVPLASTVYTVEY 146

  Rat   107 WLFGRIGCKLIPFIQLTSVGVSVFTLTALSADRYKAIVRPMDIQASH-----ALMKICLKAALIW 166
            |.:|...|.|..|::..|:|||||||||||.|||.|||.|:....:|     |.......|..||
  Fly   147 WPYGSFLCSLSEFMKDVSIGVSVFTLTALSGDRYFAIVDPLRKFHAHGGGRRATRMTLATAVSIW 211

  Rat   167 IVSMLLAIPEAVFSDLHPFHVKDTNQTFISCAPYPHSNEL-HPKIHSMASFLVFYIIPLSIISVY 230
            ::::|..:|..:.|:|.  |:....::.:.|.|||....: :.|...:..|||:|.|||.:|:|:
  Fly   212 LLAILCGLPALIGSNLK--HLGINEKSIVICYPYPEEWGINYAKSMVLLHFLVYYAIPLVVIAVF 274

  Rat   231 YYFIARNLIQSAYNLP--VEGNIHVKKQIESRKRLAKTVLVFVGLFAFCWLPNHVIYLYRSYHY- 292
            |..||.:|:.|| ::|  ::|.:   :|:.:|:::|.|||.||.:|..|:||.||.:|:  ::: 
  Fly   275 YVLIALHLMYSA-SVPGEIQGAV---RQVRARRKVAVTVLAFVVIFGICFLPYHVFFLW--FYFW 333

  Rat   293 --SEVDTSMLHFITSICARLLAFTNSCVNPFALYLLSKSFRKQFNTQLLCCQPSLLNRSHSTGR- 354
              ::.|.:....:..|.|..::|.|||.||.|||.:|.:|||.||..|.|...|  .|....|: 
  Fly   334 PTAQDDYNAFWHVLRIVAYCMSFANSCANPVALYFVSGAFRKHFNRYLFCRGAS--GRRKKRGQH 396

  Rat   355 STTCM---TSFKST 365
            .|.||   ||..||
  Fly   397 DTFCMHRDTSLTST 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GrprNP_036838.1 7tm_1 58..321 CDD:278431 103/273 (38%)
CCHa1-RNP_611241.2 7tm_4 88..>188 CDD:304433 52/99 (53%)
7tm_1 98..364 CDD:278431 103/273 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 177 1.000 Domainoid score I3490
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 219 1.000 Inparanoid score I3481
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1153238at2759
OrthoFinder 1 1.000 - - FOG0001846
OrthoInspector 1 1.000 - - mtm9138
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45695
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1046
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1010.070

Return to query results.
Submit another query.