DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32236 and CPR8

DIOPT Version :9

Sequence 1:NP_729026.1 Gene:CG32236 / 249170 FlyBaseID:FBgn0046793 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_014425.3 Gene:CPR8 / 855762 SGDID:S000005311 Length:308 Species:Saccharomyces cerevisiae


Alignment Length:214 Identity:44/214 - (20%)
Similarity:89/214 - (41%) Gaps:55/214 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 PLEQK-ASDETVSTFLPYMPSPRLGKRSAQILLRPIIYFDMAVRENNQFMGRLL-LQLYTELSPE 257
            |::.| ||.:::.....|.|.|.: ..:..|   .|::.|   .|:::..|||: :.||..:.|:
Yeast    23 PVDNKRASSDSLDLKKKYAPDPPI-THNVNI---GIVFTD---PESSEEAGRLITIDLYGTMVPK 80

  Fly   258 VVLEFV--------RMATHNDVGCHR-FVRIFSNLWMEAE------------LVPAV----HDSL 297
            .|:.|.        |:|:.:.....| |.:|..|..:|..            |.|.:    |..:
Yeast    81 TVMTFCQYVDSVKDRLASRHSYSPERDFDKILPNGAIEGSSVSSSSIEETEMLAPKLPEENHSLI 145

  Fly   298 HNHHSVKYSFLDPSKITGVLSYPWDYRRHFPQGLLSYTISFKQSVIPWQRVIFGRVCGGLRVLQN 362
            |:.         |.:::.:..         .:| |.:.|...::.:..:.|:||:|..||:.|.:
Yeast   146 HDR---------PGRVSMIKD---------DKG-LKFIIETSETPLEGESVVFGQVTAGLKDLMD 191

  Fly   363 --CHEFGTKNGKTKKTVIV 379
              .:....:|||.::.:.:
Yeast   192 KLANVKTDENGKPEQPITI 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32236NP_729026.1 KIAA1430 85..177 CDD:290590
cyclophilin 227..385 CDD:294131 36/181 (20%)
CPR8NP_014425.3 cyclophilin 65..210 CDD:412213 33/163 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.