DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32236 and CPR1

DIOPT Version :9

Sequence 1:NP_729026.1 Gene:CG32236 / 249170 FlyBaseID:FBgn0046793 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_010439.1 Gene:CPR1 / 851733 SGDID:S000002562 Length:162 Species:Saccharomyces cerevisiae


Alignment Length:174 Identity:40/174 - (22%)
Similarity:76/174 - (43%) Gaps:33/174 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 IYFDMAVRENNQFMGRLLLQLYTELSPEVVLEFVRMATHNDVGC----HRFVRIFSNLWMEAELV 290
            :|||  |..:.|.:||::.:||.::.|:....|..:.| .:.|.    ..|.|:..:..::....
Yeast     4 VYFD--VEADGQPIGRVVFKLYNDIVPKTAENFRALCT-GEKGFGYAGSPFHRVIPDFMLQGGDF 65

  Fly   291 PAVHDSLHNHHSVKYSFLDPSKITGVLSYPWDYRRHFPQ-GLLSYTIS---------FKQSV-IP 344
            .|.:.:  ...|: |....|.:         ::::|..: ||||...:         |..:| .|
Yeast    66 TAGNGT--GGKSI-YGGKFPDE---------NFKKHHDRPGLLSMANAGPNTNGSQFFITTVPCP 118

  Fly   345 W---QRVIFGRVCGGLRVLQNCHEFGTKNGKTKKTVIVTRCGLL 385
            |   :.|:||.|..|..:::.....|:.:|.||..::|.:.|.|
Yeast   119 WLDGKHVVFGEVVDGYDIVKKVESLGSPSGATKARIVVAKSGEL 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32236NP_729026.1 KIAA1430 85..177 CDD:290590
cyclophilin 227..385 CDD:294131 39/172 (23%)
CPR1NP_010439.1 cyclophilin_ABH_like 2..160 CDD:238907 38/170 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.