DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32236 and CPR4

DIOPT Version :10

Sequence 1:NP_729026.1 Gene:CG32236 / 249170 FlyBaseID:FBgn0046793 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_009995.1 Gene:CPR4 / 850433 SGDID:S000000665 Length:318 Species:Saccharomyces cerevisiae


Alignment Length:194 Identity:35/194 - (18%)
Similarity:65/194 - (33%) Gaps:65/194 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 YMPSPRLGKRSAQILLRPIIYFDMAVRENNQFMGRLLLQLYTELSPEVVLEFVRMATH------- 268
            |.|||....|.    :..|.|||...:...:  ..|..:||..:.|:.|..|..:| |       
Yeast    39 YEPSPPATHRG----IITIEYFDPVSKSMKE--ADLTFELYGTVVPKTVNNFAMLA-HGVKAVIE 96

  Fly   269 ----NDVGCH-----RFVRIFSNLWMEAELV-PAV------------------HDSLHNHHSVKY 305
                ||:..:     :..:::.|.:::..:| |.|                  ||   ....:..
Yeast    97 GKDPNDIHTYSYRKTKINKVYPNKYIQGGVVAPDVGPFTVYGPKFDDENFYLKHD---RPERLAM 158

  Fly   306 SFLDPSKITGVLSYPWDYRRHFPQGLLSYTISFK---QSVIPWQRVIFGRVCGGLRVLQNCHEF 366
            ::..|...|.                 .:.|:.|   ...:..:.|:||::..||..|.:..::
Yeast   159 AYFGPDSNTS-----------------EFIITTKADGNEELDGKSVVFGQITSGLDQLMDAIQY 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32236NP_729026.1 Hmw_CFAP97 86..177 CDD:464014
CPR4NP_009995.1 cyclophilin 67..219 CDD:238194 26/160 (16%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.