DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32236 and ROC7

DIOPT Version :10

Sequence 1:NP_729026.1 Gene:CG32236 / 249170 FlyBaseID:FBgn0046793 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_200679.1 Gene:ROC7 / 835985 AraportID:AT5G58710 Length:204 Species:Arabidopsis thaliana


Alignment Length:180 Identity:36/180 - (20%)
Similarity:69/180 - (38%) Gaps:38/180 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 IYFDMAVRENNQFMGRLLLQLYTELSPEVVLEFVRMAT------HNDVGCH----RFVRIFSNLW 284
            :|||:.:  :.:..||:::.|:.:..|:.|..|..:.|      .|....|    .|.||..:..
plant    37 VYFDVEI--DGKAAGRIVMGLFGKTVPKTVENFRALCTGEKGIGKNGKALHYKGSSFHRIIPSFM 99

  Fly   285 MEAELVPAVHDSLHNHHSVKYSFLDPSKITGVLSYPWDYR-RHFPQGLLS-------------YT 335
            ::.      .|..|.:.      :....|.|......::: :|...|.||             :.
plant   100 LQG------GDFTHGNG------MGGESIYGEKFADENFKLKHTGPGFLSMANAGQDTNGSQFFI 152

  Fly   336 ISFKQSVIPWQRVIFGRVCGGLRVLQNCHEFGTKNGKTKKTVIVTRCGLL 385
            .:...|.:..:.|:||:|..|:.|:......|.::|..|..|::...|.|
plant   153 TTVTTSWLDGRHVVFGKVVTGMDVVYKVEAEGNQSGTPKSKVVIVDSGEL 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32236NP_729026.1 Hmw_CFAP97 86..177 CDD:464014
ROC7NP_200679.1 cyclophilin_ABH_like 35..200 CDD:238907 34/176 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.