DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32236 and ROC1

DIOPT Version :10

Sequence 1:NP_729026.1 Gene:CG32236 / 249170 FlyBaseID:FBgn0046793 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_195585.1 Gene:ROC1 / 830029 AraportID:AT4G38740 Length:172 Species:Arabidopsis thaliana


Alignment Length:185 Identity:45/185 - (24%)
Similarity:77/185 - (41%) Gaps:44/185 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 PIIYFDMAVRENNQFMGRLLLQLYTELSPEVVLEFVRMAT-HNDVG-----CH----RFVRIFSN 282
            |.:||||.:  :.|..||::::|||:.:|.....|..:.| ...||     .|    :|.|:..|
plant     4 PKVYFDMTI--DGQPAGRIVMELYTDKTPRTAENFRALCTGEKGVGGTGKPLHFKGSKFHRVIPN 66

  Fly   283 LWMEAELVPAVH----DSLHNHHSVKYSFLDPSKITGVLSYPWDYRRHFPQGLLS---------- 333
            ...:.....|.:    :|::.......:|               .|:|...|:||          
plant    67 FMCQGGDFTAGNGTGGESIYGSKFEDENF---------------ERKHTGPGILSMANAGANTNG 116

  Fly   334 ---YTISFKQSVIPWQRVIFGRVCGGLRVLQNCHEFGTKNGKTKKTVIVTRCGLL 385
               :..:.|...:..:.|:||:|..||.|::...:.|:.:||..|.|:|..||.|
plant   117 SQFFICTVKTDWLDGKHVVFGQVVEGLDVVKAIEKVGSSSGKPTKPVVVADCGQL 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32236NP_729026.1 Hmw_CFAP97 86..177 CDD:464014
ROC1NP_195585.1 cyclophilin_ABH_like 4..169 CDD:238907 42/181 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.