DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32236 and AT4G34960

DIOPT Version :10

Sequence 1:NP_729026.1 Gene:CG32236 / 249170 FlyBaseID:FBgn0046793 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_195222.1 Gene:AT4G34960 / 829648 AraportID:AT4G34960 Length:224 Species:Arabidopsis thaliana


Alignment Length:189 Identity:39/189 - (20%)
Similarity:75/189 - (39%) Gaps:59/189 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 IYFDMAVRENNQFMGRLLLQLYTELSPEVVLEFVRMATHNDVG-------CH----RFVRIFSNL 283
            ::.|:.:  :.|.:||:::.||..:.|:.|..|..:.| .:.|       .|    .|.||.|..
plant    49 VFLDVDI--DGQRLGRIVIGLYGTVVPKTVENFRALCT-GEKGKTSSGKPLHYKGTPFHRIISGF 110

  Fly   284 WMEAELVPAVH------DSLHNHHSVKYSFLDPS-KITGVLSYPWDYRRHFPQGLLS-------- 333
            .::...:  :|      ||::..     :|.|.: ||           :|...|:::        
plant   111 VIQGGDI--IHGDGKSSDSIYGG-----TFPDENFKI-----------QHSHAGMVAMANTGPDS 157

  Fly   334 -----YTISFKQSVIPWQRVIFGRVCGGLRVLQNCHEF----GTKNGKTKKTVIVTRCG 383
                 :..:.|.|.:..:.|:.|:|..|   :.|....    ||.:||.:|.|::...|
plant   158 NGSQFFITTVKASWLEGEHVVLGKVIQG---MDNVFAIEGGAGTYSGKPRKKVVIADSG 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32236NP_729026.1 Hmw_CFAP97 86..177 CDD:464014
AT4G34960NP_195222.1 cyclophilin 48..213 CDD:469651 38/187 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.