DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32236 and AT2G38730

DIOPT Version :10

Sequence 1:NP_729026.1 Gene:CG32236 / 249170 FlyBaseID:FBgn0046793 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_181407.1 Gene:AT2G38730 / 818455 AraportID:AT2G38730 Length:199 Species:Arabidopsis thaliana


Alignment Length:201 Identity:42/201 - (20%)
Similarity:78/201 - (38%) Gaps:60/201 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 PSPRLGKRSAQILLRPIIYFDMAVRENNQFMGRLLLQLYTELSPEVVLEFVRMAT---------- 267
            |:|:          .|:::||:::  .....||:.::|:.:::|:....|.:..|          
plant    27 PNPK----------NPVVFFDVSI--GGIPAGRIKMELFADIAPKTAENFRQFCTGELRKAGKPL 79

  Fly   268 -HNDVGCHRFVRIFSNLWMEAELVPAVHDSLHNHHSVKYSFLDPSKITGVLSYPWD----YRRHF 327
             :.:...||.::.|        :|.: .|.|.|         |.|....:..:.::    ..:|.
plant    80 GYKECQFHRVIKDF--------MVQS-GDFLKN---------DGSGCMSIYGHKFEDENFTAKHT 126

  Fly   328 PQGLLSYTIS----------FKQSVIPW---QRVIFGRVCG-GLRVLQNCHEFGT-KNGKTKKTV 377
            ..||||...|          ...:...|   :.|:||||.| ||.|::....... .|.:.|..|
plant   127 GPGLLSMANSGPNTNGCQFFITCAKCDWLDNKHVVFGRVLGDGLLVMRKIENVAIGPNNRPKLAV 191

  Fly   378 IVTRCG 383
            ::|.||
plant   192 VITECG 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32236NP_729026.1 Hmw_CFAP97 86..177 CDD:464014
AT2G38730NP_181407.1 PLN03149 14..199 CDD:178694 42/201 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.