DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32236 and CYP5

DIOPT Version :10

Sequence 1:NP_729026.1 Gene:CG32236 / 249170 FlyBaseID:FBgn0046793 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_180557.1 Gene:CYP5 / 817546 AraportID:AT2G29960 Length:201 Species:Arabidopsis thaliana


Alignment Length:180 Identity:36/180 - (20%)
Similarity:71/180 - (39%) Gaps:38/180 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 IYFDMAVRENNQFMGRLLLQLYTELSPEVVLEFVRMAT-HNDVG-----CH----RFVRIFSNLW 284
            :|||:.:  :.:..||:::.|:.:..|:....|..:.| ...||     .|    :|.||..:..
plant    34 VYFDVEI--DGKSAGRVVIGLFGKAVPKTAENFRALCTGEKGVGKSGKPLHYKGSKFHRIIPSFM 96

  Fly   285 MEAELVPAVHDSLHNHHSVKYSFLDPSKITGVLSYPWDYR-RHFPQGLLS-------------YT 335
            ::.      .|..|.:.      :....|.|......::: :|...|:||             :.
plant    97 IQG------GDFTHGNG------MGGESIYGQKFADENFKLKHTGPGVLSMANSGEDTNGSQFFI 149

  Fly   336 ISFKQSVIPWQRVIFGRVCGGLRVLQNCHEFGTKNGKTKKTVIVTRCGLL 385
            .:...|.:..:.|:||:|..|:.|:......|.::|..|..|::...|.|
plant   150 TTVTTSWLDGRHVVFGKVVQGMDVVYKIEAEGKQSGTPKSKVVIADSGEL 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32236NP_729026.1 Hmw_CFAP97 86..177 CDD:464014
CYP5NP_180557.1 cyclophilin_ABH_like 32..197 CDD:238907 34/176 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.