DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32236 and AT2G21130

DIOPT Version :10

Sequence 1:NP_729026.1 Gene:CG32236 / 249170 FlyBaseID:FBgn0046793 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_179709.1 Gene:AT2G21130 / 816648 AraportID:AT2G21130 Length:174 Species:Arabidopsis thaliana


Alignment Length:186 Identity:39/186 - (20%)
Similarity:71/186 - (38%) Gaps:50/186 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 PIIYFDMAVRENNQFMGRLLLQLYTELSPEVVLEFVRMATHNDVGCHR-----------FVRIFS 281
            |.::|||.:  .....|:::::|||:.:|:....|..:.| .:.|..|           |.|:..
plant     5 PKVFFDMTI--GGAPAGKIVMELYTDKTPKTAENFRALCT-GEKGVGRSGKPLHFKGSSFHRVIP 66

  Fly   282 NLWMEAELVPAVHDSLHNHHSVKYSFLDPSKITGVLSYPWDY------RRHFPQGLLS------- 333
            |...:..                 .|...:...|...|...:      |:|...|:||       
plant    67 NFMCQGG-----------------DFTKGNGTGGESIYGAKFEDENFERKHTGPGILSMANAGAN 114

  Fly   334 ------YTISFKQSVIPWQRVIFGRVCGGLRVLQNCHEFGTKNGKTKKTVIVTRCG 383
                  :..:.|...:..:.|:||:|..||.|::...:.|:.:||..|.|::..||
plant   115 TNGSQFFICTVKTDWLDGKHVVFGQVVEGLDVVKAIEKIGSSSGKPTKPVVIADCG 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32236NP_729026.1 Hmw_CFAP97 86..177 CDD:464014
AT2G21130NP_179709.1 cyclophilin_ABH_like 5..170 CDD:238907 37/184 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.