DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32236 and ROC3

DIOPT Version :10

Sequence 1:NP_729026.1 Gene:CG32236 / 249170 FlyBaseID:FBgn0046793 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001318231.1 Gene:ROC3 / 816161 AraportID:AT2G16600 Length:173 Species:Arabidopsis thaliana


Alignment Length:183 Identity:43/183 - (23%)
Similarity:78/183 - (42%) Gaps:44/183 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 PIIYFDMAVRENNQFMGRLLLQLYTELSPEVVLEFVRMAT-HNDVG-----CH----RFVRIFSN 282
            |.:||||.|  ..:..||::::||.:.:||....|..:.| ...:|     .|    .|.|:...
plant     5 PKVYFDMTV--GGKSAGRIVMELYADTTPETAENFRALCTGERGIGKQGKPLHYKGSSFHRVIPK 67

  Fly   283 LWMEAELVPAVH----DSLHNHHSVKYSFLDPSKITGVLSYPWDYRRHFPQGLLS---------- 333
            ...:.....|.:    :|::..     .|.|.:.|          ::|...|:||          
plant    68 FMCQGGDFTAGNGTGGESIYGS-----KFKDENFI----------KKHTGPGILSMANAGANTNG 117

  Fly   334 ---YTISFKQSVIPWQRVIFGRVCGGLRVLQNCHEFGTKNGKTKKTVIVTRCG 383
               :..:.|.|.:..:.|:||:|..||.|:::..:.|:.:|:|.|.|::..||
plant   118 SQFFICTEKTSWLDGKHVVFGQVVEGLNVVRDIEKVGSDSGRTSKPVVIADCG 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32236NP_729026.1 Hmw_CFAP97 86..177 CDD:464014
ROC3NP_001318231.1 cyclophilin_ABH_like 5..170 CDD:238907 41/181 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.