DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32236 and Ppil6

DIOPT Version :9

Sequence 1:NP_729026.1 Gene:CG32236 / 249170 FlyBaseID:FBgn0046793 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_082706.1 Gene:Ppil6 / 73075 MGIID:1920325 Length:313 Species:Mus musculus


Alignment Length:315 Identity:60/315 - (19%)
Similarity:95/315 - (30%) Gaps:107/315 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 QLGCRLSQVKSKVDSHNPWVPPVKPLE--------------QKASDETVSTFLPY---------- 211
            |..||   .|||..:.:..:||..||:              .|...||:.|..||          
Mouse     4 QQPCR---PKSKPPACHVRLPPEPPLKLKVVGLFKSSSFQVSKTIAETLKTSYPYRFEDPVIVPL 65

  Fly   212 ------------------------------MPSPRLG-----KRSAQ-----ILLRP-------- 228
                                          :....||     |:.||     |.:||        
Mouse    66 QEFAWDQFLEEKKRELKGETWVYSSYVMCFVNDQLLGNAFDLKKWAQKVWDVIDVRPSALYEALT 130

  Fly   229 --------------IIYFDMAVRENNQFMGRLLLQLYTELSPEVVLEFVRMATHNDVGCHR---- 275
                          .:|.|:.:  :...:|||:.:||.:..|.....|..:.|.......|    
Mouse   131 LDYATKFLKDTKHDFVYLDICI--DLSPIGRLIFELYCDACPRTCTNFQVLCTGTSGFSERGTKL 193

  Fly   276 ------FVRIFSNLWME-AELVPAVHD---SLHNHHSVKYSFLDPSKITGVLSYPWDYRRHFPQG 330
                  |.|:..|.|:: .::|....|   |::.......:|..|....|||...  .:.|...|
Mouse   194 HYKDSIFHRVVQNGWIQGGDIVQGRGDDGESIYGPTFEDENFSIPHNKRGVLGMV--NKGHHTNG 256

  Fly   331 LLSYTISFKQSVIPWQRVIFGRVCGGLRVLQNCHEFGTKNGKTKKTVIVTRCGLL 385
            ...|........:..:.|.||::..|..||:......|:|.:......:...|:|
Mouse   257 SQFYITLQAAPYLDKKYVAFGQLIEGTHVLKQLELVPTENERPLLLCSIADSGVL 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32236NP_729026.1 KIAA1430 85..177 CDD:290590 3/5 (60%)
cyclophilin 227..385 CDD:294131 37/193 (19%)
Ppil6NP_082706.1 cyclophilin 146..309 CDD:294131 34/166 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.