DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32236 and PPIAL4F

DIOPT Version :9

Sequence 1:NP_729026.1 Gene:CG32236 / 249170 FlyBaseID:FBgn0046793 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001157734.2 Gene:PPIAL4F / 728945 HGNCID:33999 Length:164 Species:Homo sapiens


Alignment Length:180 Identity:35/180 - (19%)
Similarity:73/180 - (40%) Gaps:39/180 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 LLRPIIYFDMAVRENNQFMGRLLLQLYTELSPEVVLEFVRMATHNDVG------C-HRFVRIFSN 282
            ::..:::|:  :..:.:.:||:.::|:.:..|:....|..::| .:.|      | ||.:..|..
Human     1 MVNSVVFFE--ITRDGKPLGRISIKLFADKIPKTAENFRALST-GEKGFRYKGSCFHRIIPGFMC 62

  Fly   283 LWMEAELVPAVHD-SLHNHHSVKYSFLDPSKITGVLSYPWDYRRHFPQGLLS------------- 333
            ...:........| |::..     .|.|.:.|          |:|...|:||             
Human    63 QGGDFTRPNGTGDKSIYGE-----KFDDENLI----------RKHTGSGILSMANAGPNTNGSQF 112

  Fly   334 YTISFKQSVIPWQRVIFGRVCGGLRVLQNCHEFGTKNGKTKKTVIVTRCG 383
            :..:.|...:..:.|.||:|...:.:::....||.:|.||.|.:.:..||
Human   113 FICAAKTEWLDGKHVAFGKVKERVNIVEAMEHFGYRNSKTSKKITIADCG 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32236NP_729026.1 KIAA1430 85..177 CDD:290590
cyclophilin 227..385 CDD:294131 35/178 (20%)
PPIAL4FNP_001157734.2 cyclophilin 4..162 CDD:294131 33/175 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.