DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32236 and Ppil1

DIOPT Version :9

Sequence 1:NP_729026.1 Gene:CG32236 / 249170 FlyBaseID:FBgn0046793 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_081121.1 Gene:Ppil1 / 68816 MGIID:1916066 Length:166 Species:Mus musculus


Alignment Length:163 Identity:33/163 - (20%)
Similarity:56/163 - (34%) Gaps:71/163 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 PIIYFDMAVRENNQFMGRLLLQLYTELSPEVVLEFVRMAT---HNDVGCHRFVRIF--------- 280
            |.:|.:.:       ||.::|:||.:.:|:....|..:|.   :|....||.::.|         
Mouse    12 PNVYLETS-------MGVIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTG 69

  Fly   281 -----SNLW---MEAELVPAVHDSLHNHHSVKYSFLDPSKITGVLSYPWDYRRHFPQGLLSYT-- 335
                 ::::   .|.||.|.:                  |.||.             |:|:..  
Mouse    70 TGRGGASIYGKQFEDELHPDL------------------KFTGA-------------GILAMANA 103

  Fly   336 ------ISFKQSVIPWQ-----RVIFGRVCGGL 357
                  ..|..::.|.|     ..||||||.|:
Mouse   104 GPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGI 136

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG32236NP_729026.1 KIAA1430 85..177 CDD:290590
cyclophilin 227..385 CDD:294131 33/163 (20%)
Ppil1NP_081121.1 cyclophilin_SpCYP2_like 15..161 CDD:238903 32/160 (20%)
Cyclosporin A binding. /evidence=ECO:0000250 54..65 3/10 (30%)