DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32236 and Ppih

DIOPT Version :9

Sequence 1:NP_729026.1 Gene:CG32236 / 249170 FlyBaseID:FBgn0046793 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001103600.1 Gene:Ppih / 66101 MGIID:106499 Length:188 Species:Mus musculus


Alignment Length:175 Identity:39/175 - (22%)
Similarity:65/175 - (37%) Gaps:49/175 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 LRPIIYFDMAVRENNQFMGRLLLQLYTELSPEVVLEFVRMATHNDVGCHRFVRIFSNLWMEAELV 290
            :.|:::||:::  ..|.:||:.::|:.::.|:....|.:..|..               ...:.|
Mouse     9 VNPVVFFDVSI--GGQEVGRMKIELFADVVPKTAENFRQFCTGE---------------FRKDGV 56

  Fly   291 PAVHDSLHNHHSVKYSFLDPSKI-----TGVLSYPWDYR----------RHFPQGLLSYTIS--- 337
            |..:.....|..:|...:.....     |||.|.   ||          ||...||||...|   
Mouse    57 PIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASI---YRGPFADENFKLRHSAPGLLSMANSGPS 118

  Fly   338 -------FKQSVIPW---QRVIFGRVCGGLRVLQNCHEFGTKNGK 372
                   ...|...|   :.|:||::..||.|::.. ||....||
Mouse   119 TNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKI-EFQAPLGK 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32236NP_729026.1 KIAA1430 85..177 CDD:290590
cyclophilin 227..385 CDD:294131 39/174 (22%)
PpihNP_001103600.1 cyclophilin_ABH_like 11..155 CDD:238907 35/164 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.