DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32236 and Ppil2

DIOPT Version :9

Sequence 1:NP_729026.1 Gene:CG32236 / 249170 FlyBaseID:FBgn0046793 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_006522510.1 Gene:Ppil2 / 66053 MGIID:2447857 Length:564 Species:Mus musculus


Alignment Length:365 Identity:75/365 - (20%)
Similarity:138/365 - (37%) Gaps:117/365 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 DHRRLKSIKSAGDSLGFHA-RLLN------RSQLAGEFNQKQEIFRKNMELLGRINKTNRLKGGV 141
            |:..:.:|::.|:...:.| ..||      |..|..|...:|:|....       :.||     :
Mouse   112 DNTHIVAIRTTGNVYTYEAVEQLNIKAKNLRDLLTDEPFSRQDIITLQ-------DPTN-----L 164

  Fly   142 DSFN-RHFPALQSNRNKIRELADRLSQE--------NRQLGCRLSQVKSKVDSHNPWVPPVKPLE 197
            |.|| .:|..:::|...|....::..|:        |.:....|.::..:..........::|.|
Mouse   165 DKFNVSNFFHVKNNMRIIDPDEEKAKQDPSYYLKNTNSETRETLQELYKEFKGDEILAATMRPPE 229

  Fly   198 QKASDET----VSTFLPYMPSPRLGKRSAQI---LLRPIIYFDMAVRENN----QFM-------- 243
            :|..|:.    .||          ||.||..   .:.|....:.||.:.:    ||:        
Mouse   230 KKKVDQLNAAHYST----------GKVSASFTSTAMVPETTHEAAVIDEDVLRYQFVKKKGYVRL 284

  Fly   244 ----GRLLLQLYTELSPEVVLEFVRMATHNDVGCHRFVRIFSNLWMEAELVPAVHDSLHNHHSVK 304
                |.|.|:|:.:|:|:.              |..|:::....:         :|....|.|::
Mouse   285 HTNKGDLNLELHCDLTPKT--------------CENFIKLCKKQY---------YDGTIFHRSIR 326

  Fly   305 YSFL----DPSKI-TGVLSYPW------DYR---RHFPQGLLS------------YTISFKQ-SV 342
             :|:    ||:.. ||..|: |      ::|   .|..:|:||            :.|:|:. :.
Mouse   327 -NFVIQGGDPTGTGTGGESF-WGKPFKDEFRPNLSHTGRGVLSMANSGPNTNKSQFFITFRSCAY 389

  Fly   343 IPWQRVIFGRVCGG---LRVLQNCHEFGTKNGKTKKTVIV 379
            :..:..|||||.||   |..::|. |...|..:.|:.|::
Mouse   390 LDKKHTIFGRVVGGFDTLTAMENV-ESDPKTDRPKEEVLI 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32236NP_729026.1 KIAA1430 85..177 CDD:290590 20/107 (19%)
cyclophilin 227..385 CDD:294131 43/199 (22%)
Ppil2XP_006522510.1 RING-Ubox_PPIL2 38..110 CDD:319577
RING_Ubox 100..159 CDD:388418 11/46 (24%)
U-box domain, a modified RING finger 103..146 CDD:319361 7/33 (21%)
cyclophilin_RING 281..440 CDD:238904 38/174 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.