DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32236 and ppil6

DIOPT Version :9

Sequence 1:NP_729026.1 Gene:CG32236 / 249170 FlyBaseID:FBgn0046793 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001018433.1 Gene:ppil6 / 553623 ZFINID:ZDB-GENE-050522-70 Length:293 Species:Danio rerio


Alignment Length:302 Identity:61/302 - (20%)
Similarity:114/302 - (37%) Gaps:58/302 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 NMELLGRINKTN--RLKGGVDSFNRHFPALQSNRNKIREL-----ADRLSQENRQL--------G 173
            ::|::|.:||.|  ..|...:.....||. ..:...||.|     .|.||.:..:|        |
Zfish     6 HLEIVGLLNKPNFQIAKSIAEGLKNKFPD-SFDDPTIRPLLECDWQDYLSNKKTELRGEVWQYRG 69

  Fly   174 CRLSQVKSKVDSHNPWVPPVKPLEQKASDETVSTFLPYMPSPRLGKRSAQILLRPI-----IYFD 233
            |.:|....::      :...:.|...|..|...||  :.|.......:.:..:..:     |:..
Zfish    70 CIMSFANGQL------LGDERKLSGWAEKEWKFTF--HRPQALYMALAEEFYISNLRSTGHIFVY 126

  Fly   234 MAVRENNQFMGRLLLQLYTELSPEVVLEFVRMATHNDVGCHR-----------FVRIFSNLWME- 286
            |.:....:.:||||.:|::::.|:....|..:.| .:.|..:           |.|:..|.|:: 
Zfish   127 MDIENGGEAVGRLLFELFSDVCPKTCRNFKALCT-GEAGLSKSNLELSYKGSVFHRVVPNGWIQG 190

  Fly   287 AELVPAVH----DSLHNHHSVKYSFLDPSKITGVLSYPWDYRRHFPQGLLSYTISFKQSVIP--W 345
            .::.|...    :|::.......:|:......|:|...       .||..|....|..::.|  |
Zfish   191 GDISPEKKGTGGESIYGPTFEDENFVISHNKRGILGMA-------NQGAHSNGSQFYITLQPATW 248

  Fly   346 ---QRVIFGRVCGGLRVLQNCHEFGTKNGKTKKTVIVTRCGL 384
               :.|.||::..|..||:......|.|.:.|:...:..||:
Zfish   249 MDQKYVAFGQLAEGTDVLKRLEAVPTYNERPKQDCKIVACGI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32236NP_729026.1 KIAA1430 85..177 CDD:290590 17/67 (25%)
cyclophilin 227..385 CDD:294131 37/184 (20%)
ppil6NP_001018433.1 cyclophilin 125..289 CDD:294131 34/171 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.