Sequence 1: | NP_729026.1 | Gene: | CG32236 / 249170 | FlyBaseID: | FBgn0046793 | Length: | 385 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_000933.1 | Gene: | PPIB / 5479 | HGNCID: | 9255 | Length: | 216 | Species: | Homo sapiens |
Alignment Length: | 201 | Identity: | 41/201 - (20%) |
---|---|---|---|
Similarity: | 79/201 - (39%) | Gaps: | 41/201 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 206 STFLPYMPSPRLG---KRSAQILLRPIIYFDMAVRENNQFMGRLLLQLYTELSPEVVLEFVRMAT 267
Fly 268 ------HNDVGCHRFVRIF-------------SNLWMEAELVPAVHDSLHNHHSVKYSFLDPSKI 313
Fly 314 TGVLSYPWDYRRHFPQGLLSYTISFKQSVIPWQRVIFGRVCGGLRVLQNCHEFGT-KNGKTKKTV 377
Fly 378 IVTRCG 383 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32236 | NP_729026.1 | KIAA1430 | 85..177 | CDD:290590 | |
cyclophilin | 227..385 | CDD:294131 | 36/177 (20%) | ||
PPIB | NP_000933.1 | cyclophilin_ABH_like | 45..203 | CDD:238907 | 34/175 (19%) |
Prevents secretion from ER | 213..216 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0652 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |