DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32236 and ppif

DIOPT Version :10

Sequence 1:NP_729026.1 Gene:CG32236 / 249170 FlyBaseID:FBgn0046793 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001244029.1 Gene:ppif / 493394 XenbaseID:XB-GENE-1008626 Length:200 Species:Xenopus tropicalis


Alignment Length:176 Identity:36/176 - (20%)
Similarity:72/176 - (40%) Gaps:33/176 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 PIIYFDMAVRENNQFMGRLLLQLYTELSPEVVLEFVRMATHNDVGCHR---FVRIFSNLWMEAEL 289
            |::|.|:..  :||.:||:..:|..::.|:....|..:.|......::   |.||..|...:.  
 Frog    39 PMVYMDLVA--DNQPLGRVTFELRADVVPKTAENFRALCTGEKGFGYKGSTFHRIIPNFMCQG-- 99

  Fly   290 VPAVHDSLHNHHSVKYSFLDPSKITGVLSYPWD--YRRHFPQGLLS-------------YTISFK 339
                 ....||:......:..|:      :|.:  :.:|...|::|             :..:.:
 Frog   100 -----GDFTNHNGTGGKSIYGSR------FPDENFFLKHTGPGVVSMANAGPNTNGSQFFICTVE 153

  Fly   340 QSVIPWQRVIFGRVCGGLRVLQNCHEFGTKNGKTKKTVIVTRCGLL 385
            ...:..:.|:||.:..|..:::....||:|.|:..|.|:|..||.|
 Frog   154 TEWLDNKHVVFGCIKDGYDIMKKIESFGSKTGRPSKKVVVAECGEL 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32236NP_729026.1 Hmw_CFAP97 86..177 CDD:464014
ppifNP_001244029.1 cyclophilin_ABH_like 39..197 CDD:238907 33/172 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.