DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32236 and Moca-cyp

DIOPT Version :9

Sequence 1:NP_729026.1 Gene:CG32236 / 249170 FlyBaseID:FBgn0046793 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_733246.1 Gene:Moca-cyp / 43374 FlyBaseID:FBgn0039581 Length:970 Species:Drosophila melanogaster


Alignment Length:202 Identity:45/202 - (22%)
Similarity:75/202 - (37%) Gaps:55/202 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 LGKRSAQILLRPIIYFDMAVRENNQFMGRLLLQLYTELSPEVVLEFVRMAT-------------- 267
            :.||.|. ..||..:||:::  ....|||::.:|:.:::|:....|..:.|              
  Fly     3 VNKRDAG-ATRPRCFFDISL--GGLGMGRIVFELFNDVAPKTAENFRALCTGEKGFGLITGKKLQ 64

  Fly   268 HNDVGCHRFVRIFSNLWMEAELVPAVHDSLHN---HHSVKY--SFLDPSKITGVLSYPWDYRRHF 327
            :..|..||.|:.|        :|.|...|..|   ..|: |  :|.|.|          ..::|.
  Fly    65 YKGVIFHRVVKDF--------MVQAGDFSAGNGTGGESI-YGGTFEDES----------FEKKHD 110

  Fly   328 PQGLLSYTISFK-----QSVIPWQ--------RVIFGRVCGGLRVLQNCHEFGT-KNGKTKKTVI 378
            ...|||.....|     |..|..|        .|:||:|..|..:::....... :|.:..:...
  Fly   111 RPFLLSMANRGKNTNGSQFFITTQPAPHLDNIHVVFGQVISGQELVRQLEGLPVDRNSRPLQDAA 175

  Fly   379 VTRCGLL 385
            :..||.|
  Fly   176 IANCGEL 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32236NP_729026.1 KIAA1430 85..177 CDD:290590
cyclophilin 227..385 CDD:294131 41/190 (22%)
Moca-cypNP_733246.1 cyclophilin 13..180 CDD:294131 38/187 (20%)
SH3-RhoG_link 635..>718 CDD:293215
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.