DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32236 and ppig

DIOPT Version :9

Sequence 1:NP_729026.1 Gene:CG32236 / 249170 FlyBaseID:FBgn0046793 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_998629.1 Gene:ppig / 406773 ZFINID:ZDB-GENE-040426-2822 Length:687 Species:Danio rerio


Alignment Length:200 Identity:48/200 - (24%)
Similarity:72/200 - (36%) Gaps:37/200 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNNRG--VGFSEFFVKT-PTSRSIQLRAKKVAKELVMQNKDVRDKILKNKVLT----YAQFRKIM 58
            |.|||  ...|:||:.| ||.   .|....|....|:..:||...|...|..|    ||:.:.: 
Zfish   112 MANRGKDTNGSQFFITTKPTP---HLDGIHVVFGQVITGQDVIRMIESQKTDTNSRPYAEVKVL- 172

  Fly    59 KSAGNVTDLNPIT--------YKSMIEIRQSQIDHRRLKSIKSAGDSLGFHARLLNRSQLAGEFN 115
                |..:|.|.:        ::|..|...|..|        |:.||.........|.:...|..
Zfish   173 ----NCGELVPKSKAKKEKKKHQSSSESEDSSSD--------SSSDSEESEKEKKRRKKHKKEHK 225

  Fly   116 QKQEIFRKNMELLGRINKTNRLKGGVDSFNRHFPALQSNRNKIRELADRLSQENRQLGCRLSQVK 180
            :|:|...|..|..|...:....:..........|.:..||..:|...::..:|.:      |:.|
Zfish   226 KKKESKHKKKEKKGSDEEEAEPQAVSTIRPEEVPPIPENRFLMRRSPEKPKEEEQ------SKEK 284

  Fly   181 SKVDS 185
            .||||
Zfish   285 DKVDS 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32236NP_729026.1 KIAA1430 85..177 CDD:290590 15/91 (16%)
cyclophilin 227..385 CDD:294131
ppigNP_998629.1 cyclophilin 8..175 CDD:294131 21/70 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.