Sequence 1: | NP_729026.1 | Gene: | CG32236 / 249170 | FlyBaseID: | FBgn0046793 | Length: | 385 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_998629.1 | Gene: | ppig / 406773 | ZFINID: | ZDB-GENE-040426-2822 | Length: | 687 | Species: | Danio rerio |
Alignment Length: | 200 | Identity: | 48/200 - (24%) |
---|---|---|---|
Similarity: | 72/200 - (36%) | Gaps: | 37/200 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MNNRG--VGFSEFFVKT-PTSRSIQLRAKKVAKELVMQNKDVRDKILKNKVLT----YAQFRKIM 58
Fly 59 KSAGNVTDLNPIT--------YKSMIEIRQSQIDHRRLKSIKSAGDSLGFHARLLNRSQLAGEFN 115
Fly 116 QKQEIFRKNMELLGRINKTNRLKGGVDSFNRHFPALQSNRNKIRELADRLSQENRQLGCRLSQVK 180
Fly 181 SKVDS 185 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32236 | NP_729026.1 | KIAA1430 | 85..177 | CDD:290590 | 15/91 (16%) |
cyclophilin | 227..385 | CDD:294131 | |||
ppig | NP_998629.1 | cyclophilin | 8..175 | CDD:294131 | 21/70 (30%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0652 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |