DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32236 and CG7768

DIOPT Version :10

Sequence 1:NP_729026.1 Gene:CG32236 / 249170 FlyBaseID:FBgn0046793 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_648697.1 Gene:CG7768 / 39573 FlyBaseID:FBgn0036415 Length:164 Species:Drosophila melanogaster


Alignment Length:184 Identity:41/184 - (22%)
Similarity:75/184 - (40%) Gaps:49/184 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 PIIYFDMAVRENNQFMGRLLLQLYTELSPEVVLEFVRMATHNDVGCHR---FVRIFSNLWMEAEL 289
            |.:|||:|.  ..:.:||::::|.:::.|:....|..:.|......::   |.|:..|...:.  
  Fly     4 PRVYFDIAA--GGEKLGRIVMELRSDVVPKTAENFRALCTGEKGYGYKGSPFHRVIPNFMCQG-- 64

  Fly   290 VPAVHDSLHNHHSVKYSFLDPSKITGVLSYPWDYRRHFPQ----------GLLS----------- 333
                 ....|.:.           ||..|.   |...||.          |:||           
  Fly    65 -----GDFTNQNG-----------TGGRSI---YGNKFPDENFELKHTGAGVLSMANAGANTNGS 110

  Fly   334 --YTISFKQSVIPWQRVIFGRVCGGLRVLQNCHEFGTKNGKTKKTVIVTRCGLL 385
              :..:.|.:.:..:.|:||:|..|:.::|....:|:::|||.|.||:..||.|
  Fly   111 QFFICTGKTTWLDNKHVVFGKVVEGMDIVQKVESYGSQDGKTSKKVIIEDCGAL 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32236NP_729026.1 Hmw_CFAP97 86..177 CDD:464014
CG7768NP_648697.1 cyclophilin_ABH_like 4..162 CDD:238907 38/180 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.