DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32236 and ppil2

DIOPT Version :9

Sequence 1:NP_729026.1 Gene:CG32236 / 249170 FlyBaseID:FBgn0046793 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_957285.2 Gene:ppil2 / 393966 ZFINID:ZDB-GENE-040426-1096 Length:524 Species:Danio rerio


Alignment Length:420 Identity:82/420 - (19%)
Similarity:140/420 - (33%) Gaps:133/420 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NNRGVGFSEFFVKTPTSRSIQLRAKKVAKELVMQNKDVRDKILKNK----VLTYAQF-RKIMKSA 61
            ||.|...........|:.| .:.|.||... |..|:.|....:|.|    :||...| |:.:.:.
Zfish    96 NNEGKYHCPVLYTVFTNNS-HIVANKVTGN-VFSNEAVEQLNIKTKSYKDLLTDEPFTRQDLITL 158

  Fly    62 GNVTDLNPITYKSMIEIRQS----QIDHRRLKSIKSAGDSLGFHARLLN---RSQLAGEFNQKQE 119
            .:.|:|:.....:...::.:    ..|..:.|...|      :|.:..|   |..||       |
Zfish   159 QDPTNLDKFNVSNFFHVKNNMKVLDPDEEKAKQDPS------YHLKSTNLETRETLA-------E 210

  Fly   120 IFR--KNMELLGRINKTNRLKGGVDSFN-RHFPALQSNRNKIRELADRLSQENRQLGCRLSQVKS 181
            ::|  |..|||....|....| ..|.|| .|:..                          .:|.:
Zfish   211 LYRDYKGDELLASTMKEPEAK-KTDKFNAAHYST--------------------------GRVSA 248

  Fly   182 KVDSHNPWVPPVKPLEQKASDETVSTFLPYMPSPRLGKRSAQILLRPIIYFDMAVRENNQFMGRL 246
            ...|     ..:.|.....:|......:.|    :..|:...:.|           ..|:  |.|
Zfish   249 SFTS-----TAMAPATNHEADAIADDAVRY----QYVKKKGYVRL-----------HTNK--GDL 291

  Fly   247 LLQLYTELSPEVVLEFVRMATHNDVGCHRFVRIFSNLWMEAELVPAVHDSLHNHHSVKYSFL--- 308
            .::|:.:..|:....|:::       |.:                ..:|....|.|:: :|:   
Zfish   292 NVELHCDKVPKAGENFIKL-------CKK----------------GYYDGTVFHRSIR-NFMIQG 332

  Fly   309 -DPSKI-TGVLSYPW------DYR---RHFPQGLLS------------YTISFKQ-SVIPWQRVI 349
             ||:.. ||..|: |      ::|   .|..:|:||            :.|:|:. :.:..:..:
Zfish   333 GDPTGTGTGGESF-WGKPFKDEFRPNLSHTGRGILSMANSGPNTNKSQFFITFRSCAYLDRKHSV 396

  Fly   350 FGRVCGGLRVLQNCH--EFGTKNGKTKKTV 377
            ||||.|||..|....  |...|..|.|..:
Zfish   397 FGRVVGGLETLSAMENVESDPKTDKPKSEI 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32236NP_729026.1 KIAA1430 85..177 CDD:290590 19/97 (20%)
cyclophilin 227..385 CDD:294131 36/180 (20%)
ppil2NP_957285.2 Ubox 42..96 CDD:128780 82/420 (20%)
cyclophilin_RING 281..440 CDD:238904 37/184 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.