DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32236 and CG8336

DIOPT Version :9

Sequence 1:NP_729026.1 Gene:CG32236 / 249170 FlyBaseID:FBgn0046793 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001261636.1 Gene:CG8336 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster


Alignment Length:200 Identity:39/200 - (19%)
Similarity:70/200 - (35%) Gaps:65/200 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 LLR------PIIYFDMAVRENNQFMGRLLLQLYTELSPEVVLEFVRMAT-------------HND 270
            |||      |::|.|:::.:.:  .||::::|..::.|:....|..:.|             :..
  Fly     6 LLRAVKSTNPLVYLDISIGKED--AGRMIIELRKDVVPKTAENFRALCTGECGIGTLGKPLHYKG 68

  Fly   271 VGCHRFVRIFSNLWMEAELVPAVHDSLHNHHSVKYSFLDPSKITGVLSYPWDYRR----HFPQGL 331
            ...|:..|:|         |....|.:.|..|...|...|         .:|...    |..:|:
  Fly    69 TKFHKIKRVF---------VVQSGDVVKNDGSSGESIYGP---------VFDDENFELSHNEEGV 115

  Fly   332 LSYTISFKQSV--------------IPWQRVIFGRVCGGLRVL----QNCHEFGTKNGKTKKTVI 378
            :|.....|.:.              :....|:.|||..||.::    |||    |..|.....::
  Fly   116 VSMANYGKPNSNNSQFFISAAGCENLNGTNVVVGRVLRGLGIVAEMEQNC----TDEGDPTAPIV 176

  Fly   379 VTRCG 383
            :..||
  Fly   177 IRDCG 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32236NP_729026.1 KIAA1430 85..177 CDD:290590
cyclophilin 227..385 CDD:294131 36/197 (18%)
CG8336NP_001261636.1 cyclophilin 15..181 CDD:294131 34/189 (18%)
TPR repeat 285..315 CDD:276809
TPR_19 300..369 CDD:291240
TPR_1 320..353 CDD:278916
TPR repeat 320..346 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.