DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32236 and CG3492

DIOPT Version :9

Sequence 1:NP_729026.1 Gene:CG32236 / 249170 FlyBaseID:FBgn0046793 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster


Alignment Length:416 Identity:99/416 - (23%)
Similarity:157/416 - (37%) Gaps:135/416 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 GNVTDLNPI--TYKSMIEIRQSQIDHRRLKSIKSAGDSLGFHARLLNRSQLAGEFNQKQEIFRKN 124
            |..|..||:  |:...:.....|::..|.|           |...:.|.:|...:...|.:.   
  Fly    32 GPYTMTNPVYNTHNPNLVGLDGQVEDSRPK-----------HTFNVKRQELENNYRHHQRLI--- 82

  Fly   125 MELLGRINKTNRLKGGVDSFNRHFPALQSN--RNKIRELADRLSQENRQLGCRLSQVKSKVDSHN 187
                           .|.:..|..|.::|:  .|:.|||       .||...|:|.:|.||:::.
  Fly    83 ---------------PVPTSRRTMPKIRSHIVMNEQREL-------YRQHRDRMSNIKGKVNTYL 125

  Fly   188 PWVPPVKPLE---------------QKASDETVSTFLP--------------------------- 210
            |  ||...:|               .|.|:.|:.||..                           
  Fly   126 P--PPKVQIEGNGMELSYMEMLTALYKKSNNTLRTFTKSPERLAAGRWRNANLAREKERRQLEKN 188

  Fly   211 -------------------YMPSPRLGKRSAQI----------------------LLRPIIYFDM 234
                               |.|... |..|.:|                      ||||.||.|:
  Fly   189 KEFHKGGELFDPEAGKSKRYKPKSS-GSFSCEIPMHVLHRYENLMDQCDVGVLCKLLRPQIYLDI 252

  Fly   235 AVRENNQFMGRLLLQLYTELSPEVVLEFVRMATHNDVGCHRFVRIFSNLWMEAELV--PAVHDSL 297
            .||| .:..|||::||:||..|:|||||:|:.|.|:.....|.|..:.:|||..|.  |.....|
  Fly   253 EVRE-ARIQGRLIIQLFTEACPQVVLEFMRICTQNNSSAIVFNRALAPIWMEGRLAMDPQRSTEL 316

  Fly   298 HNHHSVKYSF--LDPSKITGVLSYPWDYRRHFPQGLLSYTISFKQ-SVIPWQRVIFGRVCGGLRV 359
            .|   :::.|  |:.....|:||:|..|.|...:..:::|||||. |::..:|:.||:|..|:::
  Fly   317 TN---IEHDFEVLNHGVDAGILSFPSRYVRGNARTAVNFTISFKPLSILNGRRIAFGKVRKGMQL 378

  Fly   360 LQNCHEFGTKNGKTKKTVIVTRCGLL 385
            |:...........:...:.:|.||::
  Fly   379 LERIQVAVGHLPMSHNLISLTDCGVI 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32236NP_729026.1 KIAA1430 85..177 CDD:290590 17/93 (18%)
cyclophilin 227..385 CDD:294131 56/162 (35%)
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131 50/142 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470617
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.