DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32236 and cyp33

DIOPT Version :9

Sequence 1:NP_729026.1 Gene:CG32236 / 249170 FlyBaseID:FBgn0046793 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_523773.1 Gene:cyp33 / 36984 FlyBaseID:FBgn0028382 Length:300 Species:Drosophila melanogaster


Alignment Length:390 Identity:70/390 - (17%)
Similarity:131/390 - (33%) Gaps:148/390 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 DVRDKILKNKVLTYAQFRKIMKSAGNVTDLN-PITYKSMIEIRQSQIDHRRLKSIKSAGDSLGFH 101
            :|.:::|.|..:.:          |::.|:. |..|:|......:.|::.:.:...:|.|::   
  Fly    16 EVTERLLNNAFIPF----------GDIADIQMPADYESQRHRGFAFIEYEQSEDAAAAIDNM--- 67

  Fly   102 ARLLNRSQLAGEFNQKQEIFRKNMELLGRINKTNRLKGGVDSFNRHFPALQSNRNKIRELADRLS 166
                                 .:.||.||..:.|..|                            
  Fly    68 ---------------------NDSELCGRTIRVNLAK---------------------------- 83

  Fly   167 QENRQLGCRLSQVKSKVDSHNP------WV---------PPVKPLEQKASDETVSTFLPYMPSPR 216
                       .|:.|.||..|      |:         |..:|..:|.  ||.||      .|.
  Fly    84 -----------PVRVKEDSFKPIWADDDWLQKHAGATLQPEGEPEAEKV--ETPST------GPA 129

  Fly   217 LGKRSAQILLRPIIYFDMAVRENNQFMGRLLLQLYTELSPEVVLEFVRMATHND----VGC--HR 275
            :.:::.:  ..|.::||:.:..|:  .||:::.|..::.|:....|.::.||..    .||  ||
  Fly   130 VIEKAEK--RNPQVFFDIRIGGND--AGRIVMLLRADVVPKTAENFRQLCTHEQGYGYKGCSFHR 190

  Fly   276 FVRIFSNLWMEAELVPAVHDSLHNHHSVKYSFLDPSKITGVLS-YPWDYR------RHFPQGLLS 333
            .:         .|.:....|..:|:.            ||..| |...:.      :|...|.||
  Fly   191 VI---------PEFMCQGGDFTNNNG------------TGGKSIYGKKFNDENFNLKHNSFGTLS 234

  Fly   334 -------------YTISFKQSVIPWQRVIFGRVCGGLRVLQNCHEFGTKNGKTKKTVIVTRCGLL 385
                         :..:.|...:..:.|:||.|..|..|::.....|:|:|...:.:::..||.|
  Fly   235 MANSGANTNGSQFFICTTKTDWLDNKHVVFGHVISGAEVVRKMERCGSKSGTPSQKIVIYSCGEL 299

  Fly   386  385
              Fly   300  299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32236NP_729026.1 KIAA1430 85..177 CDD:290590 8/91 (9%)
cyclophilin 227..385 CDD:294131 38/183 (21%)
cyp33NP_523773.1 RRM_PPIE 8..80 CDD:240793 15/97 (15%)
cyclophilin_ABH_like 139..297 CDD:238907 36/180 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.