DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32236 and CG7747

DIOPT Version :9

Sequence 1:NP_729026.1 Gene:CG32236 / 249170 FlyBaseID:FBgn0046793 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_611113.1 Gene:CG7747 / 36820 FlyBaseID:FBgn0034109 Length:517 Species:Drosophila melanogaster


Alignment Length:346 Identity:65/346 - (18%)
Similarity:117/346 - (33%) Gaps:104/346 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 KSAGNVTDLNPITYKSMIEIRQSQIDHRRLKSIKSAGDSLGFHARLLNRSQLAGEFNQKQEIFRK 123
            |:..::.|..|...|.:|.|:..|       .::....|..:|.: .|...|..|  ::||  ||
  Fly   142 KNWKDLVDDTPFQRKDIITIQDPQ-------KLEKYDISTFYHIK-KNLRVLTEE--EQQE--RK 194

  Fly   124 NMELLGRINKTN-RLKGGVDSFNRHFPALQSNRNKIRELADRLSQENRQLGCRLSQVKSKVDSHN 187
            | ...|||...| ..|..::...:.:...:...:..:..||:.:..:...|...:...|..    
  Fly   195 N-PASGRIKTMNLETKETLEQLQQDYQPAEEEASTSKRTADKFNAAHYSTGAVAASFTSTA---- 254

  Fly   188 PWVPPVKPLEQKASDETVSTFLPYMPSPRLGKRSAQILLRPIIYFDMAVRENNQFMGRLLLQLYT 252
              :.||..:|....|:.:..:      .|:.|:.             .||.|.. :|.|.|:|:.
  Fly   255 --MVPVSQIEAAIIDDDLVKY------ERVKKKG-------------YVRLNTN-LGPLNLELFC 297

  Fly   253 ELSPEVVLEFVRMAT---HNDVGCHRFVRIF--------------SNLW---MEAELVPAVHDSL 297
            :.:|.....|::...   :|:|..||.:|.|              .::|   .|.|..|.:    
  Fly   298 DQTPRACDNFIKHCANGYYNNVMFHRSIRNFIVQGGDPTGSGSGGESIWGKKFEDEFKPNL---- 358

  Fly   298 HNHHSVKYSFLDPSKITGVLSYPWDYRRHFPQGLLS------------YTISFKQ-SVIPWQRVI 349
                                       .|..:|:||            :.|:::. ..:..:..|
  Fly   359 ---------------------------THTGRGVLSMANSGPNTNGSQFFITYRSCKHLDGKHTI 396

  Fly   350 FGRVCGGLRVLQNCHEFGTKN 370
            ||::.|||..||........|
  Fly   397 FGKLVGGLDTLQKMENIEVDN 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32236NP_729026.1 KIAA1430 85..177 CDD:290590 18/92 (20%)
cyclophilin 227..385 CDD:294131 33/177 (19%)
CG7747NP_611113.1 RING 25..238 CDD:302633 24/108 (22%)
cyclophilin_RING 281..439 CDD:238904 33/169 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.