DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32236 and Cwc27

DIOPT Version :9

Sequence 1:NP_729026.1 Gene:CG32236 / 249170 FlyBaseID:FBgn0046793 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_017446439.1 Gene:Cwc27 / 361887 RGDID:1310697 Length:471 Species:Rattus norvegicus


Alignment Length:228 Identity:55/228 - (24%)
Similarity:82/228 - (35%) Gaps:77/228 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 SAGNVTDLNPITYKSMIEIRQSQIDH-----------------RRLK-----SIKSAGD------ 96
            :.|::.||:.       :.....::|                 :|||     ::|||||      
  Rat   255 ATGDLEDLSQ-------DAEDDSVEHDGSMEEDEKNLMRERIAKRLKKDASANVKSAGDGEKKPA 312

  Fly    97 ----SLGFHARLLNRSQLAGEFNQKQEIFRKNMELLGRINKTNRLKGGVDSFNRH---FPALQSN 154
                .|...||.|.|..||.:  ||:|...|..:  |...:.....|.|..:.|.   :.||:..
  Rat   313 SRSEELRKEARQLKRELLAAK--QKKESATKAEK--GSEEEEAVPDGPVAEYRREKQKYEALRKQ 373

  Fly   155 RNKIRELADRLSQENRQLGCRLSQVKSK----------------VDSHNPWVPPVKPLEQK---- 199
            :.|     ...|:|::.|.. |||.|||                |:....|:..|...|.|    
  Rat   374 QPK-----KGTSREDQTLAL-LSQFKSKLTQAITEMPENCAEAEVEDDEGWMSHVLQFEDKTRKV 432

  Fly   200 --ASDETVSTFLPYMPSPRLGKR---SAQILLR 227
              ||.:...||..|.|...:.||   .::.|||
  Rat   433 KDASMQDSDTFEIYDPRNPVNKRRREESKKLLR 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32236NP_729026.1 KIAA1430 85..177 CDD:290590 30/126 (24%)
cyclophilin 227..385 CDD:294131 1/1 (100%)
Cwc27XP_017446439.1 cyclophilin_CeCYP16-like 8..177 CDD:238906
TMEM119 <308..>359 CDD:292352 14/54 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.