DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32236 and Ppic

DIOPT Version :10

Sequence 1:NP_729026.1 Gene:CG32236 / 249170 FlyBaseID:FBgn0046793 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001004215.1 Gene:Ppic / 291463 RGDID:1303221 Length:212 Species:Rattus norvegicus


Alignment Length:166 Identity:34/166 - (20%)
Similarity:66/166 - (39%) Gaps:39/166 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 GKRSAQILLRPIIYFDMAVRENNQFMGRLLLQLYTELSPEVVLEFVRMATHNDVG-------CHR 275
            |.|....|:...::||  ||..::.:||:::.|:.::.|..|..||.:|| .:.|       .||
  Rat    28 GVRKRGPLVTDKVFFD--VRIGDKDVGRIVIGLFGKVVPRTVENFVTLAT-GEKGYGYKGSIFHR 89

  Fly   276 FVRIF-------------SNLWMEAELVPAVHDSLHNHHSVKY-SFLDPSKITGVLSYPWDYRRH 326
            .::.|             ..:.:..|..|..:..| .|:.:.: |..:....|            
  Rat    90 VIKDFMIQGGDFTARDGTGGMSIYGETFPDENFKL-KHYGIGWVSMANAGPDT------------ 141

  Fly   327 FPQGLLSYTISFKQSVIPWQRVIFGRVCGGLRVLQN 362
              .|...:....|.:.:..:.|:||:|..|:.|:.:
  Rat   142 --NGSQFFITLTKPAWLDGKHVVFGKVLDGMTVVHS 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32236NP_729026.1 Hmw_CFAP97 86..177 CDD:464014
PpicNP_001004215.1 cyclophilin_ABH_like 38..197 CDD:238907 31/156 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.