DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32236 and CG30350

DIOPT Version :9

Sequence 1:NP_729026.1 Gene:CG32236 / 249170 FlyBaseID:FBgn0046793 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_724715.1 Gene:CG30350 / 246556 FlyBaseID:FBgn0050350 Length:369 Species:Drosophila melanogaster


Alignment Length:394 Identity:107/394 - (27%)
Similarity:179/394 - (45%) Gaps:56/394 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 TPTSRSI-QL-RAKKVAKELVMQNKDVRDKILKNKVLTYAQFRKIMKSAGNVTDLNPITYKSMIE 77
            ||:.|.: || ..:::..:|         |:.:.|....|:.:||:              ..::.
  Fly     9 TPSQRELAQLTEQERLTAQL---------KVKERKKAAKAKPKKIL--------------GGLLM 50

  Fly    78 IRQSQIDHRRLKSIKSAGDSLGFHARLLNRSQLAGEFNQKQE--IFRK----NMELLGRINKTNR 136
            :...::.|:..:.||.|..::...|.....:::.|..|.:.|  .|.|    |::||..|::|.|
  Fly    51 VNHMKMWHQHRERIKGAISTVDAEAPNFQAARITGVNNLRDEAQTFMKRTKANIQLLVEISRTMR 115

  Fly   137 LKGGVDSFNRHFPALQSNRNKIRELADRLSQENRQLGCRLSQVKSKVD------------SHNPW 189
            ..|.::.|........|:........::|.::||..|.|:.:|.|:||            |..|.
  Fly   116 THGAINPFRYDTVHAVSSIPMALLTLEKLERDNRDFGRRILEVNSEVDSGLSDKRMREGRSSTPV 180

  Fly   190 VPPVKPLEQKASDETVSTFLPYMPSPRLGKRSAQI--LLRPIIYFDMAVRENNQFMGRLLLQLYT 252
            .|...|.:..|..|..:..||        |..|::  |.||.||||:.:::... :||.::||||
  Fly   181 APLELPPQAMAKYEAFNIPLP--------KSDAELRRLFRPRIYFDLYLKDARP-LGRFVVQLYT 236

  Fly   253 ELSPEVVLEFVRMATHNDVGCHRFVRIFSNLWMEAELVPAVHDSLHNHHSVKYSFLDPSKITGVL 317
            |.:|.|||:.::....|........|:|.|||:|.:|:.:....||.........:|....:.||
  Fly   237 EAAPLVVLQLIKSCMCNQHSKFMVKRLFPNLWLETDLMLSSDSLLHQPLEYDAKVIDHGASSYVL 301

  Fly   318 SYPWDYRRHFPQGLLSYTISFKQ-SVIPWQRVIFGRVCGGLRVLQNCHEFGTKNGKTKKTVIVTR 381
            |:...|...|... ||:.||||. :|:...||.|||:..|.::.:....:||||||..:.::.|.
  Fly   302 SFSKAYVTGFTHH-LSFAISFKPLTVVNGSRVGFGRIVKGSKICECIQSYGTKNGKLSRGLLFTS 365

  Fly   382 CGLL 385
            ||||
  Fly   366 CGLL 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32236NP_729026.1 KIAA1430 85..177 CDD:290590 24/97 (25%)
cyclophilin 227..385 CDD:294131 55/158 (35%)
CG30350NP_724715.1 KIAA1430 60..155 CDD:290590 22/94 (23%)
cyclophilin 212..369 CDD:294131 55/158 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470615
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.