DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32236 and cyn-3

DIOPT Version :10

Sequence 1:NP_729026.1 Gene:CG32236 / 249170 FlyBaseID:FBgn0046793 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_506751.1 Gene:cyn-3 / 180028 WormBaseID:WBGene00000879 Length:173 Species:Caenorhabditis elegans


Alignment Length:177 Identity:41/177 - (23%)
Similarity:76/177 - (42%) Gaps:26/177 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 RPIIYFDMAVRENNQFMGRLLLQLYTELSPEVVLEFVRMAT-HNDVG-----CH----RFVRIFS 281
            |..::||:.:  ..:..||::::||.::.|:....|..:.| .|.:|     .|    :|.||..
 Worm     3 RSKVFFDITI--GGKASGRIVMELYDDVVPKTAGNFRALCTGENGIGKSGKPLHFKGSKFHRIIP 65

  Fly   282 NLWMEAELVPAVH----DSLHNHHSVKYSFLDPSKITGVLSY----PWDYRRHFPQGLLSYTISF 338
            |..::.......:    :|::.......:|.:.....||||.    |      ...|...:..:.
 Worm    66 NFMIQGGDFTRGNGTGGESIYGEKFPDENFKEKHTGPGVLSMANAGP------NTNGSQFFLCTV 124

  Fly   339 KQSVIPWQRVIFGRVCGGLRVLQNCHEFGTKNGKTKKTVIVTRCGLL 385
            |...:..:.|:||||..||.|::.....|:::||..|..::..||.|
 Worm   125 KTEWLDGKHVVFGRVVEGLDVVKAVESNGSQSGKPVKDCMIADCGQL 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32236NP_729026.1 Hmw_CFAP97 86..177 CDD:464014
cyn-3NP_506751.1 cyclophilin_ABH_like 4..169 CDD:238907 37/172 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.