DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32236 and cyn-2

DIOPT Version :10

Sequence 1:NP_729026.1 Gene:CG32236 / 249170 FlyBaseID:FBgn0046793 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_499828.1 Gene:cyn-2 / 176807 WormBaseID:WBGene00000878 Length:172 Species:Caenorhabditis elegans


Alignment Length:182 Identity:33/182 - (18%)
Similarity:71/182 - (39%) Gaps:46/182 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 IYFDMAVRENNQFMGRLLLQLYTELSPEVVLEFVRMATHNDVG-------CH----RFVRIFSNL 283
            ::||:.:  ..:..||::::||.::.|:....|..:.| .:.|       .|    :|.||....
 Worm     6 VFFDITI--GGKKGGRIVMELYNDIVPKTAENFRALCT-GEKGKGKSGKKLHFKGSKFHRIIPEF 67

  Fly   284 WME----AELVPAVHDSLHNHHSVKYSFLDPSKITGVLSYPWDYRRHFPQGLLS----------- 333
            .::    .|......:|:|.......:|.:               :|...|:||           
 Worm    68 MIQGGDFTEGNGTGGESIHGEKFDDENFKE---------------KHTGPGVLSMANCGANTNGS 117

  Fly   334 --YTISFKQSVIPWQRVIFGRVCGGLRVLQNCHEFGTKNGKTKKTVIVTRCG 383
              :..:.|.:.:..:.|:||:|..|:.|::.....|:::|......::..||
 Worm   118 QFFLCTVKTTWLDGKHVVFGKVIEGMDVVKAIESKGSEDGAPSAPCVIADCG 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32236NP_729026.1 Hmw_CFAP97 86..177 CDD:464014
cyn-2NP_499828.1 cyclophilin_ABH_like 5..169 CDD:238907 31/180 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.