DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32236 and cyn-4

DIOPT Version :9

Sequence 1:NP_729026.1 Gene:CG32236 / 249170 FlyBaseID:FBgn0046793 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_496337.1 Gene:cyn-4 / 174674 WormBaseID:WBGene00000880 Length:523 Species:Caenorhabditis elegans


Alignment Length:356 Identity:67/356 - (18%)
Similarity:122/356 - (34%) Gaps:97/356 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 PITYKSMIEIRQSQIDHRRLKSIKSAGDSLGFHARLLNRSQLAGEFNQKQEIFRKNMELLGRINK 133
            |:|:::.       .||..:.:|.::|:.....|        ..|.|.|:...:   :||..:..
 Worm   107 PVTFRTF-------TDHSHILAIATSGNVYSHEA--------VQELNLKRNHLK---DLLTDVPF 153

  Fly   134 T----------NRLKGGVDSFNR----HFPALQSNRNKIRELADRLSQEN---RQLGCRLSQVKS 181
            |          |.|    :.||.    |.........:|::..|.:....   |::......|..
 Worm   154 TRADIIDLQDPNHL----EKFNMEQFLHVKLDLKTSEEIKKEKDAMKDPKFYIRRMNNACKSVLD 214

  Fly   182 KVDSHNPWVPPVKPLEQKASDETVSTF----LPYMPSPRLGKRSAQILLRPIIYFDMAVREN--- 239
            ::|..  :||      :|:|.||..|.    ..:....::.......::.|:.....||.:|   
 Worm   215 QLDKE--YVP------KKSSTETDETADEINAAHYSQGKVAAGFTSTVMAPVTSNKAAVLDNDTV 271

  Fly   240 -------NQFM------GRLLLQLYTELSPEVVLEFVRMATHNDVGCH---RFVRIFSNLWMEAE 288
                   |.|:      |.|.|:|:....|:....|:   ||...|.:   :|.|:..|..::. 
 Worm   272 RYSRVKKNAFVRLVTNFGPLNLELFAPKVPKACENFI---THCSNGYYNNTKFHRLIKNFMLQG- 332

  Fly   289 LVPAVHDSLHNHHSVKYSFLDPSKITGVLSYPWDYRRHFPQGLLS------------YTISFKQ- 340
                 .|.....|..:..:..|.....:..:..|.|     |:||            :.|:|:. 
 Worm   333 -----GDPTGTGHGGESIWDKPFSDEFISGFSHDAR-----GVLSMANKGSNTNGSQFFITFRPC 387

  Fly   341 SVIPWQRVIFGRVCGGLRVLQNCHEFGTKNG 371
            ..:..:..||||:.||...|....:..|:.|
 Worm   388 KYLDRKHTIFGRLVGGQDTLTTIEKLETEEG 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32236NP_729026.1 KIAA1430 85..177 CDD:290590 18/108 (17%)
cyclophilin 227..385 CDD:294131 37/177 (21%)
cyn-4NP_496337.1 Ubox 45..96 CDD:128780
cyclophilin_RING 281..440 CDD:238904 32/152 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.