DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32236 and CWC27

DIOPT Version :9

Sequence 1:NP_729026.1 Gene:CG32236 / 249170 FlyBaseID:FBgn0046793 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_005860.2 Gene:CWC27 / 10283 HGNCID:10664 Length:472 Species:Homo sapiens


Alignment Length:178 Identity:44/178 - (24%)
Similarity:65/178 - (36%) Gaps:51/178 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 RRLK-----SIKSAG------------DSLGFHARLLNRSQLAGEFNQKQEIFRKNMELLGRINK 133
            ::||     ::||||            :.|...||.|.|..||.: .:|.|...|..|......:
Human   287 KKLKKDTSANVKSAGEGEVEKKSVSRSEELRKEARQLKRELLAAK-QKKVENAAKQAEKRSEEEE 350

  Fly   134 TNRLKGGVDSFNRH---FPALQSNRNKIRELADRLSQENRQLGCRLSQVKSK------------- 182
            ... .|.|..:.|.   :.||:..::|     ...|:|::.|.. |:|.|||             
Human   351 APP-DGAVAEYRREKQKYEALRKQQSK-----KGTSREDQTLAL-LNQFKSKLTQAIAETPENDI 408

  Fly   183 ----VDSHNPWVPPVKPLEQK------ASDETVSTFLPYMPSPRLGKR 220
                |:....|:..|...|.|      ||.:...||..|.|...:.||
Human   409 PETEVEDDEGWMSHVLQFEDKSRKVKDASMQDSDTFEIYDPRNPVNKR 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32236NP_729026.1 KIAA1430 85..177 CDD:290590 26/110 (24%)
cyclophilin 227..385 CDD:294131
CWC27NP_005860.2 cyclophilin_CeCYP16-like 8..178 CDD:238906
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 206..386 25/105 (24%)
DUF5401 <302..>472 CDD:375164 38/163 (23%)
CWC27_CTD 376..428 CDD:412084 12/57 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 398..472 13/59 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.