DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32236 and ppic

DIOPT Version :10

Sequence 1:NP_729026.1 Gene:CG32236 / 249170 FlyBaseID:FBgn0046793 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_002931773.2 Gene:ppic / 100494684 XenbaseID:XB-GENE-948735 Length:208 Species:Xenopus tropicalis


Alignment Length:173 Identity:38/173 - (21%)
Similarity:72/173 - (41%) Gaps:41/173 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 IYFDMAVRENNQFMGRLLLQLYTELSPEVVLEFVRMATHNDVGC----HRFVRIFSNLWMEAELV 290
            ::|::.:...:  .||:::.|:.::.|:.|..||.:|| .:.|.    .||.|:..:..::...|
 Frog    34 VFFNVEIGGTD--AGRIVIGLFGKVVPKTVKNFVALAT-GEKGYGYKGSRFHRVIKDFMIQGGDV 95

  Fly   291 PAVHDSLHNHHSVKYSFLDPS-KITGVLSYPWDYRRHFPQGLLSYTIS---------FKQSVIP- 344
             ...|..........:|.|.: |:           :|:..|.:|...:         |..:..| 
 Frog    96 -TNGDGTGGKSIYGETFPDENFKL-----------KHYGIGWVSMANAGPDTNGSQFFISTTRPL 148

  Fly   345 W---QRVIFGRVCGGLRV-----LQNCHEFGTKNGKTKKTVIV 379
            |   :.|:||:|..|:.|     ||..:|   ::...|..|||
 Frog   149 WLNGKHVVFGKVLEGMAVVHLIELQQTNE---RDQPLKDCVIV 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32236NP_729026.1 Hmw_CFAP97 86..177 CDD:464014
ppicXP_002931773.2 cyclophilin 33..191 CDD:469651 38/173 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.