DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32236 and nktr

DIOPT Version :9

Sequence 1:NP_729026.1 Gene:CG32236 / 249170 FlyBaseID:FBgn0046793 Length:385 Species:Drosophila melanogaster
Sequence 2:XP_002939352.1 Gene:nktr / 100145676 XenbaseID:XB-GENE-992970 Length:1394 Species:Xenopus tropicalis


Alignment Length:188 Identity:42/188 - (22%)
Similarity:77/188 - (40%) Gaps:46/188 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 RPIIYFDMAVRENNQFMGRLLLQLYTELSPEVVLEFVRMAT-HNDVG-------CHR---FVRIF 280
            ||..|||:.:  |.:.:||::.||::::.|:..:.|:.:.| ...:|       |::   |.|:.
 Frog     6 RPQCYFDVEI--NREPVGRIVFQLFSDVCPKTCMNFLCLCTGEKGIGKVTGKKLCYKGSTFHRVV 68

  Fly   281 SNLWME----AELVPAVHDSLHNHHSVKYSFLDPSKITGVLSYPWDYRRHFPQGLLS-------- 333
            .|..::    :|......:|::..:     |.|.:.|.          :|....|||        
 Frog    69 KNFMIQGGDFSEGNGKGGESIYGGY-----FKDENFIL----------KHDRAFLLSMANRGKNT 118

  Fly   334 ----YTISFKQSV-IPWQRVIFGRVCGGLRVLQNCHEFGT-KNGKTKKTVIVTRCGLL 385
                :.|:.|.:. :....|:||.|..|..|::......| ...:....|.|..||||
 Frog   119 NGSQFFITTKAAPHLDGVHVVFGLVISGFEVIEQIESLKTDAASRPYADVRVIDCGLL 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32236NP_729026.1 KIAA1430 85..177 CDD:290590
cyclophilin 227..385 CDD:294131 40/186 (22%)
nktrXP_002939352.1 cyclophilin 7..174 CDD:381853 37/183 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.