DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dnajb9 and CG3061

DIOPT Version :9

Sequence 1:XP_038967719.1 Gene:Dnajb9 / 24908 RGDID:3070 Length:234 Species:Rattus norvegicus
Sequence 2:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster


Alignment Length:138 Identity:49/138 - (35%)
Similarity:76/138 - (55%) Gaps:19/138 - (13%)


- Green bases have known domain annotations that are detailed below.


  Rat    37 KNYYDILGVPKSASERQIKKAFHKLAMKYHPDKNKSPDAEAKFREIAEAYETLSDANRRKEYDII 101
            |:||::|||.|:|::.:||||:.|||::.||||||:|.|...|:.:..|...|:||.:||.||:.
  Fly   105 KDYYEVLGVSKTATDSEIKKAYKKLALQLHPDKNKAPGAVEAFKALGNAAGVLTDAEKRKNYDLY 169

  Rat   102 GHSAFTNGKGQRSNG---------SPFEQSFNFNFDDLFKD-FNLF------GQNQNTRSKKHFE 150
            |.:...||.|....|         :.:..|..|..|...:: ||:|      .||.:.|.::..:
  Fly   170 GINESHNGHGNNGGGHHGHGQYYNNEYGYSRGFQADISAEELFNMFFNGGFPQQNVHMRQQRRRQ 234

  Rat   151 NHFQTRQD 158
               |.|:|
  Fly   235 ---QARED 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dnajb9XP_038967719.1 DnaJ 35..>147 CDD:223560 46/125 (37%)
CG3061NP_650328.1 DnaJ 105..>224 CDD:223560 43/118 (36%)
DnaJ 106..167 CDD:278647 29/60 (48%)
DUF1977 269..366 CDD:286411
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1173544at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.