DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dnajb9 and CG5001

DIOPT Version :9

Sequence 1:XP_038967719.1 Gene:Dnajb9 / 24908 RGDID:3070 Length:234 Species:Rattus norvegicus
Sequence 2:NP_001245832.1 Gene:CG5001 / 33308 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster


Alignment Length:217 Identity:75/217 - (34%)
Similarity:102/217 - (47%) Gaps:42/217 - (19%)


- Green bases have known domain annotations that are detailed below.


  Rat    37 KNYYDILGVPKSASERQIKKAFHKLAMKYHPDKNKSPDAEAKFREIAEAYETLSDANRRKEYDII 101
            |:||.|||:||:|::.:||||:.|||::|||||||:.:||.||:|:|||||.|||.::|:.||..
  Fly     3 KDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSKREVYDKY 67

  Rat   102 GHSAFTNGKGQRSNGSPFEQSFNFNFDD----LFKDF--------NLFGQNQNTRSKKHF----E 150
            |.....:| |.| ||.|...||.:.|..    .|..|        :.|....|...||.|    |
  Fly    68 GEDGLKSG-GTR-NGGPSSNSFTYQFHGDPRATFAQFFGNSNPFASFFDMGDNLFDKKVFDLDTE 130

  Rat   151 NHFQTRQDGSSRQRHHFQEFSFGGGLFDDMFEDMEKMFSF---SGFDSTNRRT--------VQTE 204
            ..|.:...|....||     ..|.|     |....:..||   :.|....::.        |..|
  Fly   131 PDFFSSPFGGIGSRH-----GLGSG-----FRPSFRSHSFNVHTPFKKEQKQDPPVEHDLYVTLE 185

  Rat   205 NRFHG---SSKHCRTVTQRRGN 223
            ..:||   ..|..|.:.|..|:
  Fly   186 EIYHGCVKKMKISRRIVQADGS 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dnajb9XP_038967719.1 DnaJ 35..>147 CDD:223560 53/121 (44%)
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 75/217 (35%)
DnaJ 4..65 CDD:278647 36/60 (60%)
DnaJ_C 174..338 CDD:199909 8/34 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.