DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tbxas1 and Cyp6t3

DIOPT Version :9

Sequence 1:NP_036819.1 Gene:Tbxas1 / 24886 RGDID:3826 Length:533 Species:Rattus norvegicus
Sequence 2:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster


Alignment Length:547 Identity:146/547 - (26%)
Similarity:240/547 - (43%) Gaps:84/547 - (15%)


- Green bases have known domain annotations that are detailed below.


  Rat    15 VVTVTLSVVLLALLKWYSTSAFSRLRKLGIRHPEPSPF-----VGNLMFFRQGFWESHLEL---- 70
            ::.:.|.::.:..|.::....:...|..||.|..||.:     :|.|:|.|..|.:...:|    
  Fly     1 MLLIWLLLLTIVTLNFWLRHKYDYFRSRGIPHLPPSSWSPMGNLGQLLFLRISFGDLFRQLYADP 65

  Rat    71 RERYGPLCGYYLGRRMYIVISDPDMIKEVLVENFSNFSNRM--ASGLEPKLIADSVLMLRDRRWE 133
            |.....:.|:::.:...:::.||::|::||::||:||.||.  |...:| :.|.::.:.:...|:
  Fly    66 RNGQAKIVGFFIFQTPALMVRDPELIRQVLIKNFNNFLNRFESADAGDP-MGALTLPLAKYHHWK 129

  Rat   134 EVRGALMSAFSPEKLNEMTPLISQACEL---LLSHLKHSAASGDAFD----IQRCYCCFTTNVVA 191
            |.|..:...|:..::.::  :.||..::   |..:|....  ||..:    :.|....:||:|..
  Fly   130 ESRQCMSQLFTSGRMRDV--MYSQMLDVASDLEQYLNRKL--GDRLERVLPLGRMCQLYTTDVTG 190

  Rat   192 SVAFGIEVNSQDAPEDPFVQHCQRVFAFSTPRPLLALILSFPSIMVPLARILPNKNRDELNG--- 253
            ::.:.:.|..........:...:.:|. :.||.    :|.|.|:.     .||     :..|   
  Fly   191 NLFYSLNVGGLRRGRSELITKTKELFN-TNPRK----VLDFMSVF-----FLP-----KWTGVLK 240

  Rat   254 ---FFNTLIRNVIALRDKQTAEERRGDFLQMVLDAQRSMSSVGVEAFDMVTEALSSAECMGDPPQ 315
               |.....|.:..|.|.. .|..:||.:..:...|.|.||.....                   
  Fly   241 PKVFTEDYARYMRHLVDDH-HEPTKGDLINQLQHFQLSRSSNHYSQ------------------- 285

  Rat   316 RCHPTSTAKPLTVDEIAGQAFLFLIAGHEITTNTLSFITYLLATHPECQERLLKEVDLFMEKHPA 380
              ||         |.:|.||.:.|:||.|.::..:.|..|.||..|:.||||..|:.........
  Fly   286 --HP---------DFVASQAGIILLAGFETSSALMGFTLYELAKAPDIQERLRSELREAFISTAT 339

  Rat   381 PEYCNLQEGLPYLDMVVAETLRMYPPAFRFTRE---AAQDCEVLGQH----IPAGSVLEIAVGAL 438
            ..|..|.. ||||.||..|.||:||.|....||   :|.:...|..|    :|.|....|::..|
  Fly   340 LSYDTLMT-LPYLKMVCLEALRLYPAAAFVNRECTSSASEGFSLQPHVDFIVPPGMPAYISILGL 403

  Rat   439 HHDPEHWPNPETFDPERFTAEARLQQKPFTYLPFGAGPRSCLGVRLGLLVVKLTLLQVLHKFRFE 503
            |.|...||.|..||||||..|......|.||:||||||..|:|.|||:|.:||.::.:|.::..|
  Fly   404 HRDERFWPEPCVFDPERFGPERSRHIHPMTYIPFGAGPHGCIGSRLGVLQLKLGIVHILKQYWVE 468

  Rat   504 ACPETQVPLQLESKS-ALCPKNGVYVK 529
            .|..|...::...|| .|..:|.:|::
  Fly   469 TCERTVSEIRFNPKSFMLESENEIYLR 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tbxas1NP_036819.1 p450 47..530 CDD:278495 140/515 (27%)
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 137/503 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0158
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X40
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.